KEGG   Corynebacterium sphenisci: CSPHI_11510Help
Entry
CSPHI_11510       CDS       T05122                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
csph  Corynebacterium sphenisci
Pathway
csph00071  Fatty acid degradation
csph00280  Valine, leucine and isoleucine degradation
csph00281  Geraniol degradation
csph00310  Lysine degradation
csph00362  Benzoate degradation
csph00380  Tryptophan metabolism
csph00410  beta-Alanine metabolism
csph00640  Propanoate metabolism
csph00650  Butanoate metabolism
csph00903  Limonene and pinene degradation
csph00930  Caprolactam degradation
csph01100  Metabolic pathways
csph01110  Biosynthesis of secondary metabolites
csph01120  Microbial metabolism in diverse environments
csph01130  Biosynthesis of antibiotics
csph01200  Carbon metabolism
csph01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:csph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSPHI_11510
   00650 Butanoate metabolism
    CSPHI_11510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSPHI_11510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSPHI_11510
   00310 Lysine degradation
    CSPHI_11510
   00380 Tryptophan metabolism
    CSPHI_11510
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSPHI_11510
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CSPHI_11510
   00281 Geraniol degradation
    CSPHI_11510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSPHI_11510
   00930 Caprolactam degradation
    CSPHI_11510
Enzymes [BR:csph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CSPHI_11510
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CSPHI_11510
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CSPHI_11510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH LPD26 AlaDh_PNT_C NAD_binding_2 2-Hacid_dh_C Pyr_redox_2 DAO Ldh_1_N adh_short_C2 NAD_Gly3P_dh_N UDPG_MGDP_dh_N Sacchrp_dh_NADP NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APT91486
UniProt: A0A1L7D018
LinkDB All DBs
Position
2459139..2461385
Genome map
AA seq 748 aa AA seqDB search
MTDTMFRWDKDADGVVTLTMDAPDAPVNTMNDTFREGLVATVERLEAELAEDPKSIRGVI
ITSAKKTFFAGADLTEMVKAGPGDAAAMFEMVQGMKDALRRIERAAVPVVAAINGSALGG
GLEIALAANHRIAADARGSKIGLPEVTLGLLPGAGGIVRTVRMLGIQDALMNVLLPGKQM
RPAQALKAGLVDEVVEPGELLDRARAWVTSPEATATQPWDEKGHRIPGGTPTSPKLAMML
PSFPANLTKQLKGAPMLSPKRAMQAAIEGAQVDFDTALTIESRYFTELACGTQSKNMVQA
FFFDLQHCNGGGSRPRRADGTPFPTTEFRKVAVVGAGMMGAGIAYVCAKVGMEVVLKDVT
LENAERGKNYSEKLEAKALSRGRTTEEKSKALLDRIHPTDSYEDLHDVDIVVEAVFENTE
LKHKVHAEIEAAVPDTAVLGSNTSTLPITELGEAVERTGDFIGLHFFSPVDKMMLIEIIS
GENTSPETLAKALDFSVQIRKIPIVVNDSRGFYTSRVIATVINESMRMVAEGHQPTLVEA
ASRQAGYPAAQLQLADELNLKLMKKVREETEAAMRAAGHEIEDGGVAGLVNRMLEEFDRP
GRLEGRGFYEYVDGKRTRLWPGLWSELGAGSIPAEETNLQDLVDRMLFIEAIETQRCMDE
GVVVEDADANIGSIFGIGYPAWTGGTRQFIVNYDRFSGRPEAAKAAGVVDGALPDGTPTL
GVPGFVARAEELAAAYGERFTPPASLKG
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccatgttccggtgggacaaggacgccgacggcgtcgtcacgctcacgatg
gacgcccccgacgcccccgtcaacaccatgaacgacaccttccgcgaaggcctcgtcgcc
accgtggaacgcctcgaggccgagctcgcggaggatccgaagtccatccgcggggtcatc
atcacctccgcgaagaagaccttcttcgccggcgccgacctgaccgagatggtcaaggcc
gggcccggcgacgccgccgccatgttcgagatggtgcagggcatgaaggacgcgctgcgc
cggatcgagcgcgccgcggtgcccgtggtcgccgcgatcaacggctccgccctcggcggc
ggcctggagatcgcgctggccgcgaaccaccgcatcgccgcggacgcccgcggctccaag
atcgggctgcccgaggtgaccctcggcctgctgcccggcgccggcggcatcgtgcgcacc
gtccggatgctcggcatccaggacgcgctgatgaacgtgctgctgccgggcaagcagatg
cggcccgcgcaggcgctcaaggccggcctcgtcgacgaggtcgtcgagcccggggagctg
ctcgaccgcgcccgggcctgggtgacctcgccggaggccaccgcgacccagccctgggac
gagaaggggcaccggatccccggcggcacccccacctcgccgaagctggcgatgatgctg
ccctccttccccgccaacctcaccaagcagctcaagggcgcgccgatgctctccccgaag
cgggcgatgcaggccgccatcgagggcgcccaggtggacttcgacacggcgctgaccatc
gagtcccgctacttcaccgagctggcctgcggcacccagtcgaagaacatggtgcaggcc
ttcttcttcgatctgcagcactgcaacggcggcggctcccggccccgccgggccgacggc
acccccttcccgacgacggagttccgcaaggtcgccgtcgtcggcgccggcatgatgggc
gccggcatcgcctacgtctgcgcgaaggtgggcatggaggtcgtgctcaaggacgtcacc
ctggagaacgccgagcgcggcaagaactactccgagaagctggaggccaaggcgctgtcc
cggggccgcaccaccgaggagaagtcgaaggcgctgctggaccggatccaccccaccgac
tcctacgaggatctgcacgacgtggacatcgtggtggaggcggtgttcgagaacaccgag
ctcaagcacaaggtgcacgccgagatcgaggcggcggtgccggataccgcggtgctgggc
tccaacacctccacgctgccgatcacggagctgggcgaggcggtggagcgcaccggcgac
ttcatcggcctgcacttcttctccccggtggacaagatgatgctcatcgagatcatctcc
ggggagaacacctccccggagaccctggccaaggccctggacttctcggtgcagatccgc
aagatcccgatcgtggtgaacgactcccgcggcttctacacctcccgggtgatcgccacc
gtgatcaacgagtccatgcggatggtcgccgagggccaccagcccaccctggtggaggcc
gcctcccggcaggccggctacccggcggcgcagctgcagctcgccgatgagctgaacctg
aagctgatgaagaaggtccgcgaggagaccgaggcggcgatgcgcgccgccgggcacgag
atcgaggacggcggcgtcgccgggctggtcaaccggatgctggaggagttcgaccggccc
ggccggctggagggccgcggcttctacgagtacgtcgacggcaagcgcacccggctgtgg
ccgggcctgtggagcgagctcggcgccgggtccatcccggcggaggagaccaacctgcag
gacctggtggaccggatgctgttcatcgaggcgatcgagacccagcgctgcatggacgag
ggcgtggtggtggaggacgccgacgccaacatcggctccatcttcggcatcggctacccg
gcgtggaccggcggcacccgccagttcatcgtcaactacgaccggttctccggccgcccg
gaggcggcgaaggccgccggcgtggtggacggggcgctgcccgacggcaccccgaccctg
ggcgtgcccgggttcgtggcccgcgccgaggagctcgccgccgcctacggcgagcgcttc
accccgccggcctcgctgaagggctag

DBGET integrated database retrieval system