KEGG   Capnocytophaga sputigena: CGC55_01880Help
Entry
CGC55_01880       CDS       T05393                                 

Definition
(GenBank) leucine-rich repeat domain-containing protein
  KO
K13730  internalin A
Organism
cspu  Capnocytophaga sputigena
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-ProteinID: ATA83330
UniProt: A0A250FDW5
LinkDB All DBs
Position
complement(402003..402935)
Genome map
AA seq 310 aa AA seqDB search
MSYITFKSKLIEQKVKQYLKKKHADLLVKEGRRVLVKEEGAPLITKMLIHNDDLHSEDLA
DLQMFPNIKELELLSENITDLESLPPLEKLQKLYLNVKATDYTPLAKYKKLKKVEVYDSG
VSDITPFCELSKLKELKLSCNKLISFEGIQRLQNLTELWLDRNQITDISPLTWLSNLEYL
QLDRNQISDLSPLKALKKLNTLYLYHNEVKDLSPLKHLSLEELNLEQNKIEDLSDLVGIE
TLRNLKICFNPIKDASPLLKMPYLEFVCTDAEDIYLPLERYLGKIVVREVFGGQYPNFQE
ADTYIFSKKE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagttacattacctttaaaagcaagctcatagagcagaaagtaaagcaatatctgaaa
aagaaacacgctgaccttcttgtaaaagaggggaggagggtgttagtcaaagaagaagga
gcgcctttgattaccaaaatgctcattcataacgatgatttgcactcggaggacttagcc
gacttgcaaatgtttcctaatataaaggaattagagttgctatcggagaatattactgat
ttagaatccttaccacccttggagaagctacaaaaactctatttgaatgtcaaggcaaca
gattatacgcctcttgccaagtataaaaaactgaaaaaagtagaggtttatgacagtgga
gtgagcgatataactcctttttgcgaactatccaagctaaaagaattaaaactatcgtgc
aataaactcatttctttcgagggcatacaacgattacaaaaccttaccgaactttggttg
gatagaaaccaaatcaccgatatatcccctttaacgtggttgtccaatcttgaatatttg
caattagataggaaccaaattagcgatttatctccattgaaagccctcaagaagctcaat
actttatatttgtatcacaatgaagtaaaagacctttctcctttgaagcatttatcttta
gaggaattgaacttagagcaaaacaagatagaagaccttagcgatttggtaggtatagaa
acacttagaaacctaaagatatgttttaatcctataaaagatgcttctcctttgctaaaa
atgccttatttagagtttgtttgtacagatgctgaggatatatacttacctttagaacgt
tacctcggtaaaattgtagtaagagaagtatttggagggcaataccctaattttcaagaa
gcagatacctatatatttagtaaaaaagaatga

DBGET integrated database retrieval system