KEGG   Capnocytophaga sputigena: CGC55_11410Help
Entry
CGC55_11410       CDS       T05393                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cspu  Capnocytophaga sputigena
Pathway
cspu00240  Pyrimidine metabolism
cspu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cspu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CGC55_11410
Enzymes [BR:cspu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CGC55_11410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ATA85057
UniProt: A0A250FM58
LinkDB All DBs
Position
2423220..2423810
Genome map
AA seq 196 aa AA seqDB search
MFLENTVNNNEKAGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPAFDTRYDDTN
IVSHNANEIPSTPVEAASSIMLLADGCDVVGIDEAQFFDDEIVNVCNELANRGMRVIVAG
LDMDYKGRPFGPMPFLMATAEYVTKVHAVCTRTGNLANYSFRKVANDQQRMLGEADSYEP
LSRAAFYKAMKSGDRG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaatacagtaaacaacaacgaaaaagcgggttggatagaagtaatatgt
gggtcaatgttctcgggtaaaaccgaagaattgattcgccgattgcgccgcgctcaattt
gctaaacagaaggttgaaatcttcaaacctgcctttgatacccgctatgacgataccaat
atagtgtcgcacaatgccaatgaaatcccctcaactcccgtagaagccgcttccagtatt
atgctcttagccgatggttgcgatgtggtgggcatagacgaggctcaattttttgacgat
gaaattgtgaatgtgtgcaacgaactcgccaatcgcggtatgcgtgtgattgtagcagga
cttgatatggattacaagggcagaccttttggtccgatgccttttttgatggcaactgcc
gaatatgttaccaaggtacacgctgtttgcacccgcacgggcaatctcgccaactacagt
ttccgcaaagtcgctaatgaccaacagcgaatgctgggtgaagccgatagttacgaacct
ctgagtcgcgcagctttctataaagcgatgaagtcaggggatagggggtag

DBGET integrated database retrieval system