KEGG   Clostridium scatologenes: CSCA_0308Help
Entry
CSCA_0308         CDS       T03803                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
csq  Clostridium scatologenes
Pathway
csq00970  Aminoacyl-tRNA biosynthesis
csq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CSCA_0308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:csq03029]
    CSCA_0308
Enzymes [BR:csq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CSCA_0308
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CSCA_0308
Mitochondrial biogenesis [BR:csq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CSCA_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKA67433
UniProt: A0A0E3JYE6
LinkDB All DBs
Position
355703..357163
Genome map
AA seq 486 aa AA seqDB search
MEIQAMTAFEIKKGIEEGKFTSEEIVKKLFERIKEVDPKVEAYITLCEEEAIKSAKAVDE
KVKNGEKLGKFAGVPIAIKDNICTDGIKTTCASKMLGDFIPPYDATVIKKLKAEDAVIIG
KTNMDEFAMGSSTENSAFMKTKNPWDFKRVPGGSSGGSAAVVAAGIAPVSLGSDTGGSIR
QPAAFCGVVGLKPTYGLISRFGLVAFASSLDQIGPFGKTVEDCAMTLETIAGYDKMDSTS
SRKEVETDYLSALDGSVKGLKIGVPKEFFGKGLNEEIKACLENVMEKLREMGAVVEETTM
PITEEGLSSYYIISSAEASSNLDRYDGIRYGYRAKDYESVDDLMAQTRTEAFGKEVKRRI
MLGTYALSSGYYDAYYNRAQKLRKEITRQFKETLEKYDLILSPTSPVLPFLSGEKSENPM
EMYLADIYTVNINLAGVPALSLPCGFSKEGLPIGIQIIGPHFGEKKILKAAYALEKELKV
DTLAIK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacaagctatgacagcttttgaaataaaaaaaggtatagaagaaggaaaattt
acttcagaagaaatcgtaaaaaagctttttgaaagaataaaagaagtagatccaaaggta
gaagcgtatattacactttgtgaagaagaagctataaaatcagctaaagcagtggatgaa
aaagttaaaaatggagaaaagcttgggaaatttgcaggagtacctattgcaattaaagat
aacatatgtacagatggaataaaaactacttgtgcttcaaaaatgttgggagattttatt
cctccatatgatgctactgtaattaaaaaattaaaggcagaagatgcagttatcatagga
aaaactaatatggatgagtttgctatgggatcttccacagaaaattcagcttttatgaaa
actaaaaatccatgggattttaaaagagttcctggtggatcttcaggtggatctgctgca
gttgtagcagctggaattgcaccagtgtcattaggttctgatacaggtggttcaattcgt
cagccagcagccttttgcggagtagttggattaaagccaacttatggattaatatcaaga
tttggacttgtggcttttgcatcatctcttgatcaaataggaccttttggaaaaacagtt
gaagattgtgctatgacattagaaactatagcaggttatgataaaatggatagtactagt
tcaagaaaagaagttgaaacagattatttaagtgcattagacggaagtgttaagggatta
aaaataggagttcctaaggaattttttggaaaaggattaaatgaagaaataaaagcttgt
cttgaaaatgttatggaaaaacttagggaaatgggtgctgttgttgaagaaactactatg
cctataacagaagaaggactttcttcttattatataatatcttcagcagaagctagctca
aacttggatagatatgatggaataagatatggatacagagctaaggattatgaatctgtt
gatgatttaatggcacaaacaagaacagaagccttcggaaaagaagttaagagaagaatt
atgcttggaacatatgcattatcttctggttactatgatgcttattacaatagagctcaa
aaacttcgaaaagaaataacaagacagtttaaagaaactcttgaaaaatatgatttaata
ttgagtccaacttcacctgtacttccattcttaagtggagaaaagagtgaaaatcctatg
gaaatgtatcttgcagatatatacactgtaaacatcaacttagctggagttccagcattg
tctcttccttgcggatttagtaaagaaggacttccaataggaattcaaattataggacct
cattttggagaaaagaaaatattaaaagctgcttatgcacttgaaaaagaacttaaagtg
gatactttagctataaagtaa

DBGET integrated database retrieval system