KEGG   Clostridium scatologenes: CSCA_0459Help
Entry
CSCA_0459         CDS       T03803                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
csq  Clostridium scatologenes
Brite
KEGG Orthology (KO) [BR:csq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CSCA_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE YniB
Motif
Other DBs
NCBI-ProteinID: AKA67584
UniProt: A0A0E3M7B8
LinkDB All DBs
Position
513546..514379
Genome map
AA seq 277 aa AA seqDB search
MVIIALKIFIISIIAGVLGSILGLGGGIIITPVLTLFFGIDIKYAIGASIVSVIATSSGA
AIAYIKDKITNIRIGMFLEMATTTGAITGAFLSGMISTKYLYLIFGMVLLYSAVNMIKKS
KSELPKNVETHPIAEKLNLNGAYYDKVLNQEIQYNVTGVYGGFGMMYVAGVISGLLGIGS
GIFKVMAMDLFMKLPLKVSSATSNFMIGVTAAASAGVYLIRGDIDPKISAPVALGVLFGA
TIGTKVMQNLKSKTIRKIFIPVVVYVSVEMIIKGLGV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggttataatagctttaaaaatatttatcatatcaattatagcaggagtattaggttca
attcttggccttggaggtggcattataattacaccagtactgactttattctttggaata
gatataaaatatgctataggtgcaagtatagtatcagtaattgctacttcaagtggagca
gctattgcctatataaaagacaaaataacaaatataaggataggtatgtttcttgaaatg
gctacaacaacaggtgcaattacaggagcgtttttaagtggaatgattagcactaaatac
ctttacttgatatttggtatggttttattatattctgcagttaacatgattaaaaaatca
aaaagtgaacttcctaaaaatgtagaaacacatcctatagctgaaaaacttaatttaaat
ggagcttattatgataaagttttaaatcaggaaattcaatataatgttactggtgtctat
ggtggatttggtatgatgtatgtggcaggagttatatcaggacttcttggtataggaagt
gggatatttaaggttatggctatggatttatttatgaagcttcctctaaaggtatccagt
gctactagcaattttatgataggagtaactgcagctgcaagtgctggtgtgtatttaatt
agaggagacatagatcctaaaatttctgctcctgtagctttaggagttttatttggagca
actattggaactaaagttatgcagaatttaaagagtaaaactataagaaaaatatttata
ccagttgttgtttatgtttcagtagaaatgattataaaaggattgggggtttaa

DBGET integrated database retrieval system