KEGG   Clostridium scatologenes: CSCA_1733Help
Entry
CSCA_1733         CDS       T03803                                 

Definition
(GenBank) Succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
csq  Clostridium scatologenes
Pathway
csq00020  Citrate cycle (TCA cycle)
csq00190  Oxidative phosphorylation
csq00650  Butanoate metabolism
csq01100  Metabolic pathways
csq01110  Biosynthesis of secondary metabolites
csq01120  Microbial metabolism in diverse environments
csq01130  Biosynthesis of antibiotics
csq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSCA_1733
   00650 Butanoate metabolism
    CSCA_1733
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CSCA_1733
Enzymes [BR:csq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CSCA_1733
    1.3.5.4  fumarate reductase (quinol)
     CSCA_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_oxidored Pyr_redox_3 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKA68858
UniProt: A0A0E3K042
LinkDB All DBs
Position
complement(1861834..1863630)
Genome map
AA seq 598 aa AA seqDB search
MKIDKIINTDILVVGGSGAGSMAAVTAAEKGAKVLLAVKGKLGKSGNAIMAGAGFSMDGE
TAYYKYGVREADPKSTKEDLFKQIVKQSFYLSDQNMVEQFVNDCGECCWKLKQWIEKAGH
KVVFFGEEGYITSGKAVADGCRYGVFEVGSIDVIQDFIVADVLMEEGRAVGAIGIDIYSG
EIIEIRSKSVILATGGYQPYSFKCTVSDMTGDGMAMAYRAGAKLADMEFLLYIPAVALSP
SVYKGSIYPFLHSSMLMPIVKNGKGESILDNIPETLLKTAKESEMGKLIFTYYYGDQIAR
GKGTPNGGVYFDYSNIPFDIYEKALKKSESLMSMWYRKGFYQGNNLNTFVENIRTGIPWE
VGIGCEYSMGGIEVDENMYTGVPGLYAAGETTSGVFGAMRVADGLIEMLVQGYRSALSAC
EYIQNANDSTMKSTNVDSIIKDILLPIERKEGISPIKIHRTIERTADVGFNFRRSEEGLT
KALDEVLQMQDYAIKEMSTKSKNRVYNYEWIEAIQVRNLSTCVEAGVRAALMRKESRGTH
IRDDYKFVDNDNWLLRIMSSKGEDGKMKMSTRKPKVTTMELIKGKNKNIPDYMLSILK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagataagataattaatacggatatattagttgttggtggctctggagcagga
tcaatggcagctgtaacagctgctgaaaaaggagcaaaagtacttcttgcagtaaaagga
aagcttggaaaaagtggtaatgctattatggcaggagcaggattttctatggatggagaa
actgcatattacaaatatggagtcagggaagcagatcctaaaagtacaaaagaagactta
tttaaacaaattgtgaaacagtctttttacctaagtgatcaaaacatggttgagcagttt
gttaatgattgtggtgaatgctgctggaaactcaaacagtggattgaaaaagcaggacat
aaggttgtattctttggagaagaaggatatataacatcaggaaaagctgtcgcagatgga
tgccgatatggagtttttgaagtaggtagcattgatgttatacaagattttatagttgca
gatgttttaatggaagagggaagagctgtaggcgcaattggaatagatatatattcagga
gagattattgaaattagatcaaagtcagttattttggcaactggaggatatcaaccctat
tcctttaagtgtactgtttctgatatgactggtgatggcatggctatggcatatcgtgca
ggagcaaagcttgcagatatggaatttttattatatataccagcagttgcactttcacca
tcagtatataagggttcaatttatcctttcttacactccagtatgcttatgccaattgtt
aaaaatggtaaaggagaatcaattttagataatatacctgaaactttacttaagacggct
aaggaaagtgaaatgggaaaacttatatttacgtattattatggagatcaaattgcaaga
ggaaaaggaactccaaatggaggagtatattttgattattctaatataccttttgatatt
tatgaaaaagcattaaaaaaatctgagtcattaatgagtatgtggtatagaaaaggattt
tatcaaggaaacaatctgaatacttttgttgaaaatattagaactggtattccatgggaa
gtaggtattggctgtgaatacagcatgggtggcattgaagtagatgaaaacatgtatact
ggagtaccaggactttatgcagctggtgaaactacaagtggtgtgtttggagctatgagg
gttgcagatggactcattgaaatgttggtacaggggtatagatcagcattgtctgcttgt
gaatatatacaaaatgcaaatgattcaactatgaaaagtacaaatgttgatagtataatt
aaagacatacttttacctattgaaagaaaagagggaataagccctataaagatacacaga
actatagaaagaacagctgatgttggttttaattttagaagaagtgaagaaggacttaca
aaagctttagatgaagttttgcaaatgcaagattatgctattaaggaaatgagtactaaa
agcaaaaatagggtttataactatgagtggatagaagcaatacaggttagaaacctttca
acttgtgtagaagcaggtgtaagagctgctcttatgagaaaagaaagtaggggtacccac
atacgtgatgattataaatttgtagataatgataactggcttttaagaattatgagttca
aaaggtgaagatggaaaaatgaaaatgtctactagaaagcctaaggttacaacaatggag
cttataaaaggtaaaaataagaatattcctgattatatgctctcaattttaaaataa

DBGET integrated database retrieval system