KEGG   Clostridium scatologenes: CSCA_1735Help
Entry
CSCA_1735         CDS       T03803                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
csq  Clostridium scatologenes
Pathway
csq00020  Citrate cycle (TCA cycle)
csq00190  Oxidative phosphorylation
csq00650  Butanoate metabolism
csq01100  Metabolic pathways
csq01110  Biosynthesis of secondary metabolites
csq01120  Microbial metabolism in diverse environments
csq01130  Biosynthesis of antibiotics
csq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSCA_1735
   00650 Butanoate metabolism
    CSCA_1735
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CSCA_1735
Enzymes [BR:csq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CSCA_1735
    1.3.5.4  fumarate reductase (quinol)
     CSCA_1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 DHODB_Fe-S_bind Fer2 zf-C3HC4
Motif
Other DBs
NCBI-ProteinID: AKA68860
UniProt: A0A0E3JN52
LinkDB All DBs
Position
complement(1864206..1864517)
Genome map
AA seq 103 aa AA seqDB search
MRVKVYRFESTLENSEHYDYFDVPVVFKEKWTVMNVLDYIQEHCDSSLSYYKHSTCGHGI
CGRCTLMINGKPALACTHIVEDDKEIVLEPLKGKKLIKDLVTK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaagtatatcgatttgaatcaacattagaaaacagtgagcattatgattat
tttgatgttccagtagtctttaaagaaaaatggactgtaatgaatgttcttgattatata
caggaacattgtgacagcagtcttagttattacaaacacagtacttgcggccatggaatt
tgtggaagatgcacacttatgattaatggtaagcctgctcttgcatgtacacacatagta
gaggatgataaagaaattgttcttgaacctttaaaaggaaaaaaattaataaaagattta
gttactaaatag

DBGET integrated database retrieval system