KEGG   Clostridium scatologenes: CSCA_5002Help
Entry
CSCA_5002         CDS       T03803                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
csq  Clostridium scatologenes
Pathway
csq00473  D-Alanine metabolism
csq00550  Peptidoglycan biosynthesis
csq01100  Metabolic pathways
csq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CSCA_5002
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CSCA_5002
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CSCA_5002
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csq01011]
    CSCA_5002
Enzymes [BR:csq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CSCA_5002
Peptidoglycan biosynthesis and degradation proteins [BR:csq01011]
 Precursor biosynthesis
  Amino acid ligase
   CSCA_5002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK ATP-grasp CPSase_L_D2 GARS_A ATPgrasp_ST ATP-grasp_4 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AKA72127
UniProt: A0A0E3K445
LinkDB All DBs
Position
5421371..5422273
Genome map
AA seq 300 aa AA seqDB search
MKIGVIMGGISSEREVSLNSGKEIVKYFNKEKYDVVPIVIDKKDDIIAKAKDIDFAFIAL
HGKFGEDGIIQAVLETMDIPYSGCGPLTSGVCMDKDITKKILRSAGINTADWLSVKSVEE
IDYDLIEKIGYPVVVKPNCGGSSVATNIIKKKEDIESAVSLALDYDTEVMIEKYVKGDEV
TCCMINGEVLPLIAIKPKAEFFDYTAKYADGGSDEIIVKLEEGIQNKIEEMALNCWKVLK
CNVYVRVDMIVKEGVPYVLELNTLPGMTKNSLFPKSAKAVNMSYTDLLEKITEYSLAEVR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggagttataatgggtggaatatcttctgaaagagaagtttccttaaattca
ggaaaagagatagtaaaatattttaataaagagaaatatgatgttgttccaatagtaata
gataaaaaagatgatattattgcaaaagcaaaagatatagattttgcttttatagcactt
catggtaagtttggagaagatgggataatacaagcagtacttgaaactatggatattcct
tattctggatgtggtccattaacaagtggtgtatgtatggataaagatataactaaaaag
atattaagatcagcaggtataaatacagcagattggttgtctgtaaaatctgtagaagaa
atagattacgatcttatagaaaaaataggctaccctgtagtagtaaagcctaattgtgga
gggtcaagtgtagctacaaatataatcaagaaaaaagaagatatagaaagtgctgttagc
ttggcattagattatgatacagaagttatgatagaaaaatatgttaaaggtgatgaagta
acttgctgtatgattaatggagaagttcttccattaatagctataaagcctaaagcagaa
ttctttgattatacagcaaaatatgctgatggtggttcagatgaaattatagtaaaactt
gaagaaggaattcaaaataaaatagaagaaatggcattaaactgctggaaagttttaaaa
tgtaatgtgtatgtaagagtagatatgatagtaaaagaaggtgtgccatatgtgcttgaa
ttaaatacactaccaggtatgactaaaaatagcttattccctaaaagtgcaaaggctgta
aatatgtcatatacagatttattagagaaaataactgaatattcattagctgaagtaaga
taa

DBGET integrated database retrieval system