KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c17190Help
Entry
Cspa_c17190       CDS       T02467                                 

Gene name
trxB3
Definition
(GenBank) thioredoxin reductase TrxB
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
csr  Clostridium saccharoperbutylacetonicum
Brite
KEGG Orthology (KO) [BR:csr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cspa_c17190 (trxB3)
Enzymes [BR:csr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Cspa_c17190 (trxB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like FAD_oxidored Thi4 FAD_binding_3 DAO K_oxygenase NAD_binding_8 AlaDh_PNT_C NAD_binding_7 Lycopene_cycl SelR
Motif
Other DBs
NCBI-ProteinID: AGF55489
UniProt: M1MC30
LinkDB All DBs
Position
complement(1894198..1895181)
Genome map
AA seq 327 aa AA seqDB search
MDFNLSFSTADIFRSQPELEPDNIYDLLIIGAGPAGLNAALYAKRKGLDVAIITKRKGGQ
ILDTSTVDNYLGFANISGEGLVDEFLNHVEKLEIPILEDTEVIDTFSDNLIHQIVLSTGE
TYKTKTLLVATGSKPRQLDVPGEIKYAGKGVAYCAICDAPLFKNRNVFIAGGGNSAVEAA
LDIAKFANSVTLIHRSQLRADKILVDQLYSHSKISVYLKTKILEITGDDVMTGLSLENTE
TLKQFRLKGDGIFIEIGHTPNIGPFKDILKLNERGEIITNERKETNIPGIFAAGDITNSM
YKQIIIAASDGAIAALAINEYINQNKL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggattttaatttatccttcagtactgcagatatatttagaagtcagccagagcttgaa
cctgacaacatctatgatttactaattatcggagctggtccagctggacttaatgccgct
ttatatgcaaaacgtaaaggacttgatgttgcaattattacaaaaagaaaaggtggtcaa
atccttgatacttctaccgttgataactatctaggttttgcaaacattagtggcgaaggc
ttagttgatgaatttttaaatcatgttgaaaaattagaaatacccattctagaagatact
gaagttattgatactttttctgataatttaatacaccagattgtattatcaactggtgaa
acttataaaaccaaaacattattggttgccacaggctcaaaacctcgacaattagatgta
cctggtgaaattaagtatgctggcaaaggcgttgcttattgcgcaatatgtgatgctcct
ctatttaaaaatagaaatgtattcattgctggtggcggtaattcagctgtcgaagcagca
ctcgatattgctaaatttgcaaattctgtaactttaattcacagaagccagttaagggca
gataaaattttagtggatcaactttatagtcattccaaaatatctgtatatttaaaaaca
aagatattagaaattacaggtgatgatgttatgacagggctatcacttgaaaataccgaa
acgcttaaacaattccgcttaaaaggcgatggaatatttatagaaataggccatacacct
aatataggtccttttaaagatattttaaagctcaatgaacgtggagaaattatcactaat
gaaagaaaagaaactaatataccagggattttcgctgctggtgatataacaaattcgatg
tataaacaaattattattgctgcaagcgatggtgctattgccgcacttgcaatcaatgaa
tatattaatcaaaacaaattatag

DBGET integrated database retrieval system