KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c17560
Entry
Cspa_c17560       CDS       T02467                                 

Gene name
gtfA1
Definition
(GenBank) sucrose phosphorylase GtfA
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
csr  Clostridium saccharoperbutylacetonicum
Brite
KEGG Orthology (KO) [BR:csr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cspa_c17560 (gtfA1)
Enzymes [BR:csr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     Cspa_c17560 (gtfA1)
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AGF55526
UniProt: M1ML49
LinkDB
Position
1937782..1939251
AA seq 489 aa
MAVKNKVQLITYPDSLGGDLKTLNNVLLKYFSDIFEGGIHILPPFPSSGDRGFAPLTYLE
IEPSFGTWEDIKAIGENFDILVDLMVNHISKKSKYFQDFIKKGRNSEYADLFITLDKIWE
DGKPKQEDIEKMFLRRKLPYSTFTVEETGEEEKVWTTFGKTDPSEQIDLYIKSQKAKDLL
KEFFMNFKKQNVKIVRLDAVGYVIKKLGTSCFFVEPEIYDFLDWIKELADSLEIELLPEV
HSHYSIQYKLADHGFWIYDFILPYTILDTLINKSSEKLCEYLKVRPKKQFTMLDCHDGIP
VKPDMDDLIDTKEARKLVDVCVERGSNLSLILSEEHKAEDGFDVHQIRCSYYSVLNCDDD
AYLAARAIQFFTPGIPQVYYVGALAGENDTENVKKTGEGREINRHNFSIEEIEQSLKKDV
VQRLLKLIKFRNEYDAFNGEFKVLDCAKDEIKLIWEKDSKFCELFIDIKTNESVINYIDE
VGNLAKYKI
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcggttaaaaataaagtacagcttataacttaccccgattctcttggaggcgactta
aaaacacttaataatgtacttttaaaatacttctctgatatatttgaaggtggaatacat
atactccctccatttccctcatctggagatagaggttttgctccattaacctatttagaa
attgagccaagctttggtacctgggaggatataaaagctataggagaaaactttgatatt
ttagtagatttaatggttaatcacatttctaagaagtctaaatattttcaggattttatt
aaaaaaggacgaaattcagaatatgcagacttgtttataaccttagacaaaatttgggaa
gatggaaaaccaaaacaagaagatattgaaaaaatgtttttacgtagaaaattaccatat
tcaacttttactgtggaagagactggtgaagaagagaaggtatggactacatttggtaag
acagatccttctgaacaaattgatttatatataaaatctcaaaaagcaaaagatcttctt
aaagaattttttatgaactttaagaagcaaaatgttaaaatagtaagattagatgcagtg
gggtatgttattaaaaaacttggaacaagctgcttctttgtagagccagaaatatatgac
ttccttgattggattaaagaactggcagattcattggaaattgaattgctgcctgaagtt
cattcacactattcaattcaatataaactagcagatcacggattttggatatacgatttt
attttaccttatactattttagatacgttaataaataagtctagtgagaaactttgtgag
taccttaaagtacgtcctaaaaaacagtttacaatgcttgactgtcatgatggaattcca
gttaagccagatatggatgatcttatagataccaaggaggcaagaaaattagttgatgta
tgtgtagaaagaggttcaaatcttagcctcattttatcagaggaacacaaggctgaggat
ggttttgatgtacatcaaataagatgttcttactattcagtacttaattgtgatgatgat
gcatacttagcagctagagcaattcaattttttacacctggaataccacaagtatattat
gtaggagcattagcaggagaaaatgacactgaaaatgtaaagaaaaccggtgaaggtcgt
gaaatcaatcgtcataattttagtattgaggaaattgaacagtcccttaaaaaagatgta
gttcaaagacttttaaagctaataaaattcagaaatgagtatgatgcttttaatggagaa
tttaaggttttagattgtgctaaagatgaaattaaacttatttgggaaaaggactctaaa
ttttgtgaattatttatagatattaaaaccaatgagagtgttataaactatattgatgaa
gtgggtaatttggctaaatataagatataa

DBGET integrated database retrieval system