KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c39410Help
Entry
Cspa_c39410       CDS       T02467                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase AhpF
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
csr  Clostridium saccharoperbutylacetonicum
Brite
KEGG Orthology (KO) [BR:csr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cspa_c39410 (ahpF)
Enzymes [BR:csr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Cspa_c39410 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored FAD_binding_3 DAO Glutaredoxin AlaDh_PNT_C Thi4 K_oxygenase NAD_binding_8 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGF57698
UniProt: M1MNC2
LinkDB All DBs
Position
4270412..4271941
Genome map
AA seq 509 aa AA seqDB search
MILDDELKEQLAEYIDLLENDILIKASVGSDELSEDTTALVEELAAMSPKIKVENATLLR
TPSFSINRIGEDTGVIFSGLPLGHEFNSLILAMLQVSGRPPKIDDKTIEAIKNLKGTYNF
ETYMSLTCHNCPDVVQALNIISILNPNVTNVTIDGESFYDELDEKNIMAVPAVYLNGEFF
GLGRMTLEEILAKLSSAPTGADLNDKEPYDVLVVGGGPAGASAAIYSARKGIRTGIIVER
FGGQVLDTLGIENLIGVKYTEGPKLGANLEEHVKDYDVDIINLQRSKNIIKKDLFEVELE
NGAILKSKTVIISTGAKWRNVGVPGEQEFKNKGVTYCPHCDGPLFKGKEVAVIGGGNSGI
EAAIDLAGIANHVTVFEFMPELKADSVLLNRLNSLTNVTVLKNVQTKEFTGTSKIDGITY
VVRDTNEVKHIDVDGIFVQIGLVPNTEWLNDTVEKNKLGEIVIDNHGATNIPGIFAAGDC
TDSPYKQIIISMGTGATAALSAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgatgatgaattaaaagaacaattagcagaatatattgatcttttggagaat
gatattttaattaaagcaagtgttggttctgatgaattatcagaagatactactgcatta
gttgaagaattagctgctatgtctccaaaaataaaagttgagaatgcaactttattaaga
acacctagttttagcattaatagaattggagaagatacaggagttattttttcaggactt
ccattaggtcacgaatttaattcattaattttagctatgctacaagttagcggaaggcct
ccaaagattgacgataaaacaatagaagctattaaaaatttaaaaggaacatacaatttt
gaaacttatatgagcttaacttgccacaactgtcctgatgtcgttcaagccctaaacata
attagtattctaaatcctaatgttactaacgtaacaattgatggtgaatctttctatgat
gagcttgatgaaaaaaatataatggcagtaccagctgtttatttaaatggagaatttttt
ggtcttggtcgtatgactcttgaagaaattctagcaaaattaagcagtgcccctactgga
gcagatttaaatgataaagagccttatgatgtacttgtcgtaggaggtggtcctgctgga
gcaagtgcagcaatttattcagctagaaaaggcataagaactggaataattgttgaacgc
tttggtggacaggtattagacactttaggaattgaaaatttaattggtgtgaaatatact
gaaggtccaaaacttggtgctaatcttgaagagcatgttaaggattatgatgttgatatt
ataaatttacaaagatctaaaaacattatcaaaaaagacttatttgaagttgaattagaa
aatggtgctattttaaaaagtaaaactgtaataatttcaacaggggctaaatggcgaaac
gtcggtgttcctggagaacaagaatttaaaaacaaaggtgtaacttactgtcctcactgt
gatggtcctttatttaaaggaaaagaagttgcagtaataggcggaggtaattcaggaatt
gaagccgctattgatttagctggaattgctaatcacgtaacagtttttgaatttatgcca
gaactaaaggctgattcagtattactaaaccgccttaacagtttaactaatgttactgtt
cttaaaaatgttcaaacaaaagagtttacaggtactagcaagatagatggaatcacatat
gttgtgcgtgatactaatgaagttaagcatattgatgttgatggtatatttgttcaaata
ggacttgtaccaaatactgaatggcttaatgacacagttgaaaaaaataaattaggtgaa
attgtaattgataaccatggcgctacaaatataccaggtatttttgcagcaggagattgt
acagatagcccatataagcaaattattatttctatgggcacaggtgcaactgcagccttg
agtgcatttgattatttaataagaaattaa

DBGET integrated database retrieval system