KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c40500Help
Entry
Cspa_c40500       CDS       T02467                                 

Gene name
dpnB
Definition
(GenBank) type-2 restriction enzyme DpnII
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
csr  Clostridium saccharoperbutylacetonicum
Brite
Enzymes [BR:csr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     Cspa_c40500 (dpnB)
Prokaryotic defense system [BR:csr02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    Cspa_c40500 (dpnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII HcyBio
Motif
Other DBs
NCBI-ProteinID: AGF57805
UniProt: M1LX50
LinkDB All DBs
Position
complement(4385207..4386058)
Genome map
AA seq 283 aa AA seqDB search
MKRNFDKWLETFRSSIADYEYYVNFKKVFQNVDNIKVELNILNSLIGSSDIENDFENLME
RYPETLKCIPILLAVRNNEILAMDEDGSFVYDFRKKNQTIEQYKIFMKKTGLFDLLANHG
ITNLIDYVVGVETGLDSNGRKNRGGHLMEDLVEGYIQKEGITDYYKEMYLSDVEKKWDID
LSQLSNDGKTAKRFDFVVKTPSMIYGIETNFYASSGSKLNETARSYKMLAEESKEIQGFT
FVWLTDGLGWQSAKRNLEETFDVLDTIYNIKDLEIGIMREVFK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaattttgataaatggttagagacttttagaagcagtatcgcagattatgaa
tattatgtgaattttaaaaaggtatttcaaaatgtagataatatcaaggttgagttgaac
attttaaattcattgattggctcttctgatatagaaaatgatttcgagaatttaatggaa
cgatatccagaaactttgaaatgtataccaattttattagctgtaagaaataatgaaatt
ttagctatggatgaagatggttcatttgtatatgattttagaaagaaaaatcaaacaata
gaacaatataaaatttttatgaaaaaaacaggactctttgatttattggctaatcatggt
attacaaatcttattgactatgtagtaggggttgaaacaggacttgattcaaatggaaga
aagaaccgtggaggacatctcatggaagatttggtcgaaggttatatacaaaaggaaggt
ataactgattattataaagaaatgtatttaagtgatgtagaaaagaaatgggacatagat
ttgtcgcaactttctaatgatggaaaaactgctaaacgttttgactttgtagttaaaact
cctagtatgatttatggtattgaaactaatttttatgctagttcaggttcaaaattaaat
gaaactgctagaagttataagatgttagcagaagaatcgaaagaaatacaaggttttact
tttgtttggcttactgatgggcttggatggcaatctgctaaaagaaatttagaagaaaca
tttgacgttttagatactatttataatattaaagaccttgagattggtataatgagagaa
gtttttaaataa

DBGET integrated database retrieval system