KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c46190Help
Entry
Cspa_c46190       CDS       T02467                                 

Gene name
ppm
Definition
(GenBank) phosphoenolpyruvate phosphomutase Ppm
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00440  Phosphonate and phosphinate metabolism
csr01100  Metabolic pathways
csr01120  Microbial metabolism in diverse environments
csr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Cspa_c46190 (ppm)
Enzymes [BR:csr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Cspa_c46190 (ppm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like DUF3173
Motif
Other DBs
NCBI-ProteinID: AGF58372
UniProt: M1N4K1
LinkDB All DBs
Position
complement(5035189..5036487)
Genome map
AA seq 432 aa AA seqDB search
MKTVYVAMSADIIHQGHLNVLNEARKFGDVIVGLHTDDVIRGYWRNPIMKYEERKEVVSN
IKGVVSVIPQDSLDQVPNIREIKPDYVLHGDDWKEGVQKVLRDKVIEAIGEWGGKLVEVP
YTQGVSISKLDEELAQIGITPQMRMKSLKELIYSKKPVRILEAHNGLTGLIVEKTKVEKE
GRIKEFDGMWISSLCDSTAKGKPDIELVDLTSRLNTINDILEVTTKPIIVDGDTGGQIEH
FVYTVKTLERLGVSAIIIEDKTGLKKNSLFGTAVVQTQDTIEHFSDKIRAGREARVTSDF
MIISRIESLIAGAGMEDAIERAKAYIEAGTDGIMIHSKEKNGEEIIKFCRRYNGFENKVP
LVVVPTSYNFMKEDELIELGVSVVIYANHLIRSAYPAMVNTAKSILENGRSKEASINCMP
IKEILTLIPGGM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtttatgtagctatgagtgcagatattattcatcaaggacatttaaatgta
ttaaatgaagcaagaaaatttggagatgtaatagttggattgcatactgatgatgtaata
agaggatattggagaaatcctataatgaaatatgaagagagaaaagaagttgtaagcaat
atcaaaggggttgtatcagtaattcctcaagatagtttagatcaagtgcctaatattaga
gaaattaaacctgattatgttctgcatggtgatgattggaaagaaggagtacaaaaagta
cttagagataaagtaattgaagcaataggtgaatggggaggaaaacttgttgaggttcca
tatacccaaggagtttctatttcaaaattagatgaagaattggcgcagataggaataaca
cctcagatgagaatgaaaagtcttaaggaactaatttattccaaaaaaccagttaggata
cttgaagctcataatgggttgacaggacttatcgtagaaaaaacaaaggttgaaaaagaa
ggtagaataaaagagtttgatggtatgtggataagttctttatgtgattcaactgccaag
ggtaagccagatattgaattagtagatttaacttcaagattaaatacaattaatgatatt
ttggaagtcactacaaaacctataatagttgacggagatacaggtggacaaattgaacat
tttgtttatactgttaaaaccttagaaagattaggtgtatcagctattattattgaagat
aaaactggacttaagaaaaattcattatttggtacagctgttgttcaaacacaggatacc
atagaacatttttcagataagatcagagctggaagagaagctcgggttactagtgatttt
atgataatttcaagaattgaaagtttgattgcaggagctggaatggaagatgctattgaa
agggcaaaagcttatattgaggcaggaacagatggaattatgatccatagtaaagaaaaa
aatggtgaagagataataaaattttgtagaagatataatgggtttgaaaataaagttcca
ttagtagtagttcctacttcatataattttatgaaagaagatgaattaattgaattagga
gttagtgttgttatatatgcaaatcatttaatccgaagtgcttatccagcaatggtaaat
acggcaaagagtattttggaaaatggaaggtcaaaagaagcatcaattaattgtatgccg
ataaaagaaatattgactttaattccaggaggaatgtag

DBGET integrated database retrieval system