KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c47020Help
Entry
Cspa_c47020       CDS       T02467                                 

Gene name
mro
Definition
(GenBank) aldose 1-epimerase Mro
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00010  Glycolysis / Gluconeogenesis
csr00052  Galactose metabolism
csr01100  Metabolic pathways
csr01110  Biosynthesis of secondary metabolites
csr01120  Microbial metabolism in diverse environments
csr01130  Biosynthesis of antibiotics
Module
csr_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cspa_c47020 (mro)
   00052 Galactose metabolism
    Cspa_c47020 (mro)
Enzymes [BR:csr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Cspa_c47020 (mro)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim PAS
Motif
Other DBs
NCBI-ProteinID: AGF58455
UniProt: M1LYT3
LinkDB All DBs
Position
5134973..5136028
Genome map
AA seq 351 aa AA seqDB search
MAIGKRSFGKMPNGEEVDIYTLKNDNGMKIEISTYGGTIVSGIVSDKSGDFHDIVLGYDN
LNSYLSGDKYFGALIGRFGNRIQYGKFTLNNKEYTLVQNNGENHLHGGTKGFDKVIWNAK
VIETEPNTLELSYLSPDGEEGYPGNLDIKVKYVLTEDNALEINYLATTDEDTVVNLTNHA
YFNLSGHSSGDVLKQKLMINADKFTPNDKYSIPTGEITSVENTPMDFRTLTPIGTNINSD
HEQIVFGNGFDHNWVLNSNGSLDVKSAQAVDENTGIVMDVYTTTPGVQFYSGNFLDGSDI
GKNNTAYNIRNGFCLETQFFPNSINCSNFKSPILKAGEIYKHKTIYKFSIL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtggcaataggaaaaagatcttttggaaaaatgcctaatggagaagaagttgatatctat
acattaaaaaatgataatggaatgaaaatagaaataagtacttatggtggtacaattgta
tccggaatagtttcagataaaagcggagattttcatgatatagtattaggttatgataat
ctaaatagttatttaagtggagataagtatttcggtgcattaataggacgtttcggaaat
cgaatacaatatggtaagtttactcttaataataaggaatatactttagtacaaaataat
ggagaaaatcatcttcatggtggcactaaaggctttgataaagtaatctggaatgctaaa
gtaattgaaactgaaccaaatacattagagctttcttatttaagtcctgatggtgaagaa
ggataccctggaaatcttgatataaaagttaaatatgtactcactgaagataatgcttta
gaaattaattatttagcaactactgatgaagatactgttgtaaatcttactaaccatgct
tattttaatttatctggacattcttctggagatgtgcttaagcaaaagttaatgattaat
gcagataaattcactccaaacgacaaatattcaattcctactggggaaataacaagtgtt
gaaaatacacctatggattttaggactttgactcctattggtacaaatataaattctgat
catgaacaaattgtttttggaaatggatttgaccataattgggtactaaattctaatggt
tcacttgatgtgaagtcagctcaagctgttgatgaaaacactggcatagtaatggatgta
tatacaacaactccaggagttcaattctacagtggaaatttccttgatggatctgatata
ggtaaaaacaatactgcctacaatattagaaatggtttctgccttgaaactcaatttttc
cctaattctattaattgcagcaatttcaaatcaccaatattgaaagctggggaaatatac
aagcataaaacaatatataaattttccatactataa

DBGET integrated database retrieval system