KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Cst_c08630Help
Entry
Cst_c08630        CDS       T02440                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
css  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00010  Glycolysis / Gluconeogenesis
css00020  Citrate cycle (TCA cycle)
css00620  Pyruvate metabolism
css01100  Metabolic pathways
css01110  Biosynthesis of secondary metabolites
css01120  Microbial metabolism in diverse environments
css01130  Biosynthesis of antibiotics
css01200  Carbon metabolism
Module
css_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:css00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cst_c08630 (acoC)
   00020 Citrate cycle (TCA cycle)
    Cst_c08630 (acoC)
   00620 Pyruvate metabolism
    Cst_c08630 (acoC)
Enzymes [BR:css01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cst_c08630 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT
Motif
Other DBs
NCBI-ProteinID: AGC67862
UniProt: L7VM89
LinkDB All DBs
Position
908706..910076
Genome map
AA seq 456 aa AA seqDB search
MATPVVMPRQGNTVESCILTQWFVKKGDRVKEGDLLFAYETDKAAFEEEAKVSGTVLEIF
FNEGDDIPVLTNVCVIGEEGEDITPFIPGGAPGNEEGRETGKIEPLEKTADEAQKPAETI
MAKDGEERIFISPRARNLAEKIGADFRFATPTGPEGRIIERDIRKLQQEGYLVTPAAKEE
YLNLDRPVEGSGIGGRVTTADVGRTATISVSGERADETPKAETVTSEYEEVKLTNIRKVI
AKTMHESLSQMAQLTMNISFDATEILNLRQKFKATAEVIGLANITLNDILIYAVSRVLPK
HRDLNAHFMGDTIRYFKNVHMGVAVDTERGLMVPTLFNANLKSLNEIAMETKELANACRK
GTISPDLLKGGTFTITNLGVYGIESFTPVINPPQTAILGVNTVERKFREKDGVIEPYMSM
SLSLTFDHRAVDGAPAARFLKDLKDALENFTVLLAK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccggttgtaatgcccaggcagggaaatacggttgaaagttgcattttaacc
cagtggttcgtaaaaaaaggagacagggttaaggaaggcgatttgctttttgcctatgaa
accgacaaagcggcttttgaagaagaggcgaaggtaagcggtaccgttcttgagattttt
ttcaacgagggtgatgatatacccgtccttacaaatgtctgtgtaataggtgaggaagga
gaggatattacgccatttattcccggaggtgcaccgggaaatgaagagggacgggaaacg
gggaagattgagcctttggaaaaaacggcggatgaagctcaaaagccggctgaaacaatc
atggcgaaagacggggaagaacggatattcatatccccgagggcaagaaatcttgccgaa
aaaataggcgccgattttagatttgcgacccccacagggccggaaggaagaataattgaa
cgggatataaggaagttgcagcaggaagggtatctggtcacaccggctgcgaaggaggaa
tatctgaacctggatcggcctgtagaaggctcaggtataggcggacgcgtcaccaccgcc
gacgttggccgcaccgcaacaatttccgtgtccggtgaaagggccgacgaaacgccgaaa
gccgaaaccgttacttcggaatatgaagaagttaaactcacgaacattcgcaaggttatt
gcaaaaacaatgcatgagtcgttgtcgcagatggctcagctgacgatgaatatctctttt
gatgcgaccgaaatactgaatttaaggcaaaaattcaaagcaaccgctgaagtgattggg
cttgcaaacattacattgaacgatatcctgatttatgcggtaagccgcgtattgccgaag
catagagacctgaatgcccattttatgggcgatacgataagatattttaaaaacgtccat
atgggcgttgccgttgacaccgaacgcgggttaatggtacccactcttttcaatgccaat
ctcaagtccctgaatgagatagcaatggaaacaaaagaactggcaaacgcttgcagaaag
ggaacaatcagccctgatcttctgaagggcggaacattcacaataaccaatcttggggtt
tacgggattgaatccttcacacccgttattaacccgccgcaaacggccattttgggagtt
aataccgttgaacggaagttcagggaaaaagacggtgtaatagaaccgtatatgtcaatg
tccctgtctttaacctttgatcaccgggctgtggacggggcgcccgcagcaagattcctg
aaggatttgaaagatgccctcgaaaactttaccgttctgcttgcaaaatag

DBGET integrated database retrieval system