KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Cst_c09950Help
Entry
Cst_c09950        CDS       T02440                                 

Gene name
fliY2
Definition
(GenBank) cystine-binding periplasmic protein FliY
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
css  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Brite
KEGG Orthology (KO) [BR:css00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:css02000]
    Cst_c09950 (fliY2)
Transporters [BR:css02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    Cst_c09950 (fliY2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd NMT1 NMT1_3 OpuAC SurA_N_2
Motif
Other DBs
NCBI-ProteinID: AGC67993
UniProt: L7VQY9
LinkDB All DBs
Position
1067097..1067876
Genome map
AA seq 259 aa AA seqDB search
MRRKIAILMLACITMLAVTACKDSADTGKRTFTVGFDKDFPPFGFVDENGNYTGFDLEVA
AEVAKRLGWELKLQPISWEAKDMELSAGNIDCIWNGFTINGREDDYTWTDPYMANRQVFV
VRADSGIKTLDDLKGKTVAVQLDSSAEAALNDRPDLLESFGEYIKTADYNTAMMDLEAGA
VDAVAMDETVAMYQIEKRGLKFSILEETLAEEMYGVGFRLGNEELRDTVQKVLEEMAADG
TLSEISVKWFGKDVTIIGK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaaaatagcgatacttatgcttgcctgtataacgatgcttgcagtaacggcg
tgcaaagacagcgccgacaccggtaaaagaacatttaccgtaggttttgataaggatttc
ccacccttcggttttgtagacgaaaacggcaactacaccggttttgacctggaagtggcc
gcagaggtggcaaaaaggctgggttgggaactgaagctccagccgatatcctgggaagcc
aaagacatggaactttcggcgggcaatattgactgtatatggaacgggtttacaataaac
ggccgtgaggacgattatacgtggaccgatccttatatggccaacagacaggtttttgtc
gtaagagccgattcaggtattaaaacccttgacgatttgaaggggaaaacggtggctgtg
cagttggattccagtgccgaggctgcgctgaatgacaggcccgatctgcttgaaagtttc
ggcgaatacataaagaccgcagattacaatacggctatgatggatttggaagcaggagcc
gtggatgcagtggcaatggatgaaacagttgctatgtatcagatagaaaaaaggggcttg
aaattttccatcctcgaagaaacattggctgaggaaatgtacggcgtgggtttccgtctg
ggaaatgaagaactgagggatacggtacaaaaggtactcgaagaaatggcagcggacggc
acattgtccgaaatttcggttaagtggtttggaaaggatgttacgataataggaaaataa

DBGET integrated database retrieval system