KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c16020Help
Entry
Cst_c16020        CDS       T02440                                 

Gene name
ddl1
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00473  D-Alanine metabolism
css00550  Peptidoglycan biosynthesis
css01100  Metabolic pathways
css01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:css00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cst_c16020 (ddl1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cst_c16020 (ddl1)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Cst_c16020 (ddl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:css01011]
    Cst_c16020 (ddl1)
Enzymes [BR:css01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Cst_c16020 (ddl1)
Peptidoglycan biosynthesis and degradation proteins [BR:css01011]
 Precursor biosynthesis
  Amino acid ligase
   Cst_c16020 (ddl1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 GARS_A RimK ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AGC68588
UniProt: L7VSR3
LinkDB All DBs
Position
complement(1731008..1732030)
Genome map
AA seq 340 aa AA seqDB search
MSDVPECPGYRVGITFNLKRNQNDEYEDEQAEYDSLSTIEAIGKAISKAGCETILLEADT
DLPEKLRNIKPDIVFNIAEGKGGRGREAQVPSILNLYSIPFTGSDETTLCVALDKGLAKR
IVRSCRIKTPDFFIWKDKDTEIPSNLHFPVIVKPNAEGSSKGLIGNSIAKNRKELINLLC
EKWDRYHQALLVEEYVSGREFTVGILGNGNEKRVFRPMEIIVSPEGNPDRSRIYSFHVKT
NYQKYVRYRCPADLDPQTEEKMISCSEKIYDILECKDFARIDYILSESNEIYFIEINPLP
GLAPGYSDYPMLAEYNGMGYDELVKAILNSGLKRYGMAAV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgttcccgaatgtccagggtacagggttggaattacttttaaccttaaacga
aaccaaaacgatgagtatgaggatgaacaggccgaatatgacagtttaagcactattgaa
gccattggaaaagcaatcagcaaagcaggctgcgaaaccatcttacttgaagcggatacc
gatttgcctgaaaagctgcggaatatcaaaccggatatagttttcaacatagccgaggga
aagggaggaagaggcagagaagcccaggtaccgtcaattctcaatctttactcaattcca
ttcacaggttccgatgaaacaacattgtgcgtagctctcgacaagggtcttgcgaaaaga
attgttcggtcgtgcagaataaaaacgccggattttttcatttggaaggataaagatact
gaaataccgtcaaatcttcattttcccgtcattgtaaaaccaaatgccgaaggttcaagc
aagggacttataggaaattcaattgcaaaaaaccgaaaagaattgatcaatctgttgtgc
gaaaaatgggacagatatcatcaggctcttcttgtagaagaatatgtatcaggacgcgaa
tttaccgttgggattctcggcaacggaaacgagaaacgtgtattcaggcccatggaaata
attgtttctcccgaaggcaaccccgatcgcagcagaatatacagtttccacgttaaaacc
aattatcagaaatatgtaagatacaggtgccctgcggacctggacccgcaaaccgaagaa
aaaatgatcagctgttccgaaaaaatatatgacattctggaatgcaaagattttgcgaga
atagattatatactttctgaaagcaacgaaatttattttattgaaatcaatcctttgcct
ggtctggcgcctggttacagtgactaccccatgctggcagaatacaacggaatgggctat
gatgagctggttaaggcgattctcaacagcggtctgaaacgttacggaatggcagcagta
tag

DBGET integrated database retrieval system