KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Cst_c21730Help
Entry
Cst_c21730        CDS       T02440                                 

Gene name
alkH
Definition
(GenBank) NAD-dependent aldehyde dehydrogenase AlkH
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
css  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00010  Glycolysis / Gluconeogenesis
css00053  Ascorbate and aldarate metabolism
css00071  Fatty acid degradation
css00280  Valine, leucine and isoleucine degradation
css00310  Lysine degradation
css00330  Arginine and proline metabolism
css00340  Histidine metabolism
css00380  Tryptophan metabolism
css00410  beta-Alanine metabolism
css00561  Glycerolipid metabolism
css00620  Pyruvate metabolism
css00625  Chloroalkane and chloroalkene degradation
css01100  Metabolic pathways
css01110  Biosynthesis of secondary metabolites
css01120  Microbial metabolism in diverse environments
css01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:css00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cst_c21730 (alkH)
   00053 Ascorbate and aldarate metabolism
    Cst_c21730 (alkH)
   00620 Pyruvate metabolism
    Cst_c21730 (alkH)
  Lipid metabolism
   00071 Fatty acid degradation
    Cst_c21730 (alkH)
   00561 Glycerolipid metabolism
    Cst_c21730 (alkH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cst_c21730 (alkH)
   00310 Lysine degradation
    Cst_c21730 (alkH)
   00330 Arginine and proline metabolism
    Cst_c21730 (alkH)
   00340 Histidine metabolism
    Cst_c21730 (alkH)
   00380 Tryptophan metabolism
    Cst_c21730 (alkH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cst_c21730 (alkH)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cst_c21730 (alkH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cst_c21730 (alkH)
Enzymes [BR:css01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Cst_c21730 (alkH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AGC69137
UniProt: L7VQS2
LinkDB All DBs
Position
complement(2354643..2356013)
Genome map
AA seq 456 aa AA seqDB search
MKDIKDIVKMQREYFAKGETLDLDYRINALRRLKEYIKKYEEEICGALKEDLNKSPFEAY
ATEIGFVYAELNEMIKKLPRWSRVKRVRTPLTQFKSVSYIVSEPYGVVLIMSPWNYPFQL
SVTPLIGAIAGGNCAIVKPSAYSPRTSSVIAKIIGECFENKYIAVIEGGREANGELLNEK
FDYIFFTGSVGVGKVVMEAASRNLTPVTLELGGKSPCIVDKSANIEISAKRIVWGKTVNS
GQTCVAPDYCFAHREIKQDLIEAMKKCIRDFYGESPCKNPEYPKIVNEKHFKRLLALLDS
GEVVEGGDFDEENLKISPTILDNVSFDSPVMQEEIFGPILPVIEYDDIEKVISYINSRPK
PLALYLFTGDRKLEKTVIKRVPFGGGCINDTLVHLATSHMPFGGVGESGMGGYHGKWSFD
TFTHKKSIMKKSFLMDIELRYPPYHDKLGILKKLMR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacataaaagacattgtaaaaatgcaaagggaatatttcgcaaaaggcgaaacg
ctggatttggattatcggattaatgctctcagaaggcttaaggaatatataaagaaatat
gaggaggagatttgcggagcgcttaaagaagatttgaacaaatctccttttgaggcctat
gcgacggaaatcggatttgtttacgccgaattgaatgaaatgataaaaaagcttccacgg
tggagcagagtgaaaagagtcagaacaccgcttacacagtttaaatcggtttcctacatt
gtatccgaaccttacggcgttgttcttataatgtcaccgtggaattatccctttcagctt
tcagtaacgccgctgatcggggcaatagcgggcggaaactgtgccatagtgaagccttcg
gcatattctccccgaacttcgtcggttattgcaaaaataattggagaatgttttgaaaat
aagtatatagccgtaattgaaggaggaagagaagcaaacggcgagcttttgaacgaaaaa
ttcgattatatcttcttcaccggaagtgtcggggtagggaaagtagtgatggaagcggca
tcgagaaacctgactccggtcactctggaactgggcggaaaaagcccgtgcatagtggat
aaaagcgcaaatattgaaatatccgcaaaaagaattgtctgggggaaaacggtgaacagc
ggacagacgtgcgttgcgcccgactactgttttgcccaccgggaaatcaaacaggatctt
atcgaggcgatgaaaaagtgtatcagggatttttatggcgaatcgccgtgcaaaaatccc
gagtaccctaaaattgtgaatgaaaagcatttcaagcggctgctggcgcttcttgacagc
ggcgaagttgtcgaaggcggggattttgacgaagaaaaccttaagatatcccctacgata
cttgacaacgtaagctttgattcccctgtaatgcaggaggaaatattcgggcccattctc
ccggttatagaatatgatgatatcgaaaaggtgatctcgtatataaacagccgcccgaaa
cccctggcgctgtatctttttaccggggacagaaaactggaaaaaacggttataaaaaga
gttcctttcggaggaggctgtattaacgatacccttgtccatcttgccacgtcccatatg
cctttcggaggtgtaggggaaagcggaatgggcggttatcacggaaagtggagttttgac
acgtttacccataaaaagagtattatgaaaaaatcatttttgatggatattgaacttaga
tatccgccttatcatgataaattgggcatattgaaaaaattaatgaggtaa

DBGET integrated database retrieval system