KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Cst_c22810Help
Entry
Cst_c22810        CDS       T02440                                 

Definition
(GenBank) transketolase, N-terminal subunit
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
css  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00030  Pentose phosphate pathway
css01100  Metabolic pathways
css01110  Biosynthesis of secondary metabolites
css01120  Microbial metabolism in diverse environments
css01130  Biosynthesis of antibiotics
css01200  Carbon metabolism
css01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:css00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cst_c22810
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Cst_c22810
Enzymes [BR:css01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Cst_c22810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh XFP_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AGC69241
UniProt: L7VS98
LinkDB All DBs
Position
complement(2472965..2473822)
Genome map
AA seq 285 aa AA seqDB search
MDKKEILRLKRIATNIRKNILRATCAAGSGHPGGSLSIADIMTYLYFKEMNIDPKDPRNP
DRDRFVMSKGHCAPVLYATLAERGFFPKEDLITLRKTTSYLEGHPNMKSTPGVDMSTGSL
AQGLSTAVGMALAGKLDGKNYRVFVGMGDGELEEGLVWEAAMAAAHYKLDNLICFVDYNG
LQIDGKITEVMNPEPIADKFTAFGWYVQSIDAHDFNQIEQAVENAKKQKGRPNMIVAHSI
KGKGVSFMENQPGWHGVAPKPEECERGLAELDAYLASLDAEEQAL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaaggaaattctccgtctgaaaagaatagccacaaatatacgaaagaatatt
ttaagagcaacctgtgcggccggcagcggtcatcccggaggttccttatcgatagctgat
attatgacttatttatattttaaggagatgaatatagaccctaaagatccgcgcaacccg
gacagggacaggtttgtaatgtcaaaggggcattgtgcgcccgtgctttacgcaaccctt
gctgaaaggggttttttcccgaaagaggatttgattacgcttagaaaaaccacaagctac
cttgaaggtcatccgaacatgaagagcacgccgggtgttgacatgtctaccggttctctg
gcgcaggggttgtctacggctgttggaatggcactggccggaaaactggacgggaaaaat
taccgtgtatttgtaggaatgggcgatggcgagcttgaagaagggcttgtctgggaggcg
gcaatggctgctgcccactataagctggataatctcatctgtttcgttgattacaacggg
cttcagatagacggaaaaatcaccgaggttatgaatcctgaaccaatagctgataaattt
acggcctttggctggtatgttcagtcaatagatgcccatgatttcaatcagattgagcag
gcagtggaaaacgcaaagaagcagaaaggcagacccaatatgattgttgcccactccata
aaaggaaaaggcgtatctttcatggagaatcagccgggctggcatggagtggctccgaaa
cctgaagaatgtgagagaggtctggcggaactggatgcgtacctggcatcgctggatgcg
gaggagcaggctctgtaa

DBGET integrated database retrieval system