KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Cst_c25130Help
Entry
Cst_c25130        CDS       T02440                                 

Gene name
alr
Definition
(GenBank) alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
css  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
css00473  D-Alanine metabolism
css01100  Metabolic pathways
css01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:css00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cst_c25130 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Cst_c25130 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:css01011]
    Cst_c25130 (alr)
Enzymes [BR:css01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Cst_c25130 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:css01011]
 Precursor biosynthesis
  Racemase
   Cst_c25130 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGC69470
UniProt: L7VMM1
LinkDB All DBs
Position
complement(2717038..2718249)
Genome map
AA seq 403 aa AA seqDB search
MRIKIGKEGRVLSFNYYRAWAEINLDNIAHNVREVAKRVGKMTEIMAVVKADAYGHGVFE
TVPTLLENGASRLAVSMLDEAIQLREFGIKVPILVLGYTEPSRAEDIIKYNITQTVFSHE
LAKALSDAAVKLGRQAKIHIKIDTGMGRVGFKPGYGAVKDVVRISELPGIIIEGLFSHFA
SADEADPEYTRLQFERFESIVQELNRIGILIPVKHIANSAAVIQYPNLHLNMVRPGIILY
GLYPSDEVDRKLIDIRPAMELKAKVVHVKEVEEGTPISYGRTFVTKRKSRIATLPIGYAD
GFSRLLSNKGRVLIHGQYAPIVGTICMDQCMVDVTDIDGEVKTGDEAVIFGVQGNNRITV
EEIAELCNTINYEVVCLIGKRIPRVYLRGGKVVNVVNYLRQTF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgaataaaaatagggaaggaaggacgtgttttgagctttaactattacagggcatgg
gctgaaatcaatttggacaatatagcgcataatgtaagggaagtggcaaaacgagtaggt
aaaatgactgaaataatggcggtggttaaagccgatgcttatggccatggcgtgtttgaa
acggttcccactcttttggaaaacggagcaagcaggcttgcggtttcaatgctggacgag
gcaatccagttaagggagtttggtataaaggttccaattctggtgttaggctataccgaa
ccgtcgagagccgaagatattattaaatataacattacacagacggtttttagccatgag
cttgcaaaagctttgtccgatgccgcggttaagctgggcaggcaggcgaaaatacatata
aaaatagacaccggaatgggcagagtaggttttaagcccggatacggtgcggtaaaagac
gtagttagaataagcgaacttccgggtataattatagagggactgttcagccattttgct
tcggccgatgaagccgacccggaatatacgaggctccagttcgaacgctttgaaagcatt
gtccaggagcttaaccggataggaatattaattcccgtgaaacatattgccaacagtgcc
gctgtaatccaatacccaaacctgcatctgaacatggtgcggcccggcataattctttac
ggactgtatccgtccgacgaggtggacaggaaacttattgacatcaggccggcgatggag
ctgaaggcaaaggttgtgcatgtcaaggaagtggaggaaggaacgccgataagctatggc
cggacattcgtgacaaagcggaaaagccgcatagcgacattgccgatagggtatgctgac
ggtttctcaaggcttctttcaaacaaaggccgggtgttgatacatgggcagtatgcccct
atcgtggggacgatctgtatggatcagtgcatggttgatgtcacggatatagacggggaa
gtgaagacaggagatgaagcggtgatattcggtgttcagggaaataacaggataaccgtt
gaagagatagcggagctttgcaatactataaattacgaggttgtatgtctgataggaaaa
aggatcccacgggtttatttaagaggcggaaaggttgtcaatgtggtgaattacctcagg
caaactttttaa

DBGET integrated database retrieval system