KEGG   Acetoanaerobium sticklandii: CLOST_0138Help
Entry
CLOST_0138        CDS       T01334                                 

Gene name
argJ
Definition
(GenBank) ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00220  Arginine biosynthesis
cst01100  Metabolic pathways
cst01110  Biosynthesis of secondary metabolites
cst01130  Biosynthesis of antibiotics
cst01210  2-Oxocarboxylic acid metabolism
cst01230  Biosynthesis of amino acids
Module
cst_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CLOST_0138 (argJ)
Enzymes [BR:cst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     CLOST_0138 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     CLOST_0138 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ ExbD
Motif
Other DBs
NCBI-ProteinID: CBH20268
UniProt: E3PU07
LinkDB All DBs
Position
complement(161968..163221)
Genome map
AA seq 417 aa AA seqDB search
MAIEKEEIPMNKYIVIDGGVSSPKGFLSSGIHSGVKKSGKNDLSLVYSEVPAYSWAMFTT
NKACAAPVTLSKSHIQDQNIQAIVINSGNANACTGQKGLSDAYEMATVTASALNIAPQNV
IVSSTGLIGLPLEMDKIKAGIAKAASALSVNGSEEAAKGIITTDAHLKTIAVQVTIDNKV
VTIGGMAKGSRMIHPQMATMLSIVTTDANIDKTYLKYLLNDTTEKTYNMISIDGDTSTND
MVAVMANGKACNNELNANHPEVQSFANAFAFVNEYLAKSIVADGEGATKFIEVQVVNSNT
LASAKLAAKSILTSNLVKTSLFGEESNWGRILCSIGYSGAQFDMDKLEISLVGDNKETIK
IVENGQSTIFCKESAKKLLKERNITILVDFKTGSQNSIAWGCDLSHDYVKINSSHIS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggccatagaaaaggaggagatacctatgaataaatatatagtaatagatggaggagta
agctctccaaaaggctttctttccagcggaattcacagtggagtcaaaaaaagtggaaaa
aacgaccttagcctagtatatagcgaggttcctgcatatagctgggcaatgtttactact
aataaagcctgcgccgctcctgtcactttatcaaaatcacatattcaagaccaaaatatc
caagcaatagtaataaatagtggcaatgccaatgcctgtactggtcaaaaagggctaagc
gatgcctacgaaatggctacagtaacagccagtgctctaaatattgctcctcaaaatgta
attgtatcttcaactggactaatcggcctacctcttgagatggataaaataaaagcagga
atagctaaagccgcgagtgctctatccgtaaacggaagcgaggaagctgcaaaaggcata
ataactacagacgcacacctcaaaaccatagctgtgcaagtaactatagacaataaagtc
gtaactataggcggcatggcaaaaggctctagaatgatacatcctcagatggcaaccatg
ctcagcatagtaactacagatgcaaatatagataagacttacctcaaatatctccttaat
gacactactgaaaaaacctacaatatgatatccatcgacggtgatacaagcacaaacgat
atggtagctgttatggcaaacggcaaggcttgtaataacgagctaaatgcaaatcatcca
gaagtacaaagctttgcaaatgcctttgcctttgtaaatgaatacctagcaaaatcaata
gttgcggatggagaaggagctacaaaatttatagaggtgcaagttgttaacagcaacact
ctagcttctgcaaagctcgctgcaaaatctattttgacctctaatcttgtcaaaacttca
ctatttggcgaagagagcaattggggcagaattctctgcagtataggctactcaggagct
cagtttgatatggataaattagaaatcagccttgtaggagataataaagaaaccataaaa
atagtagaaaatggtcaaagtactatattttgcaaggaatcagcaaaaaaacttctcaaa
gagagaaatataactatccttgtagacttcaaaacaggcagtcaaaactctatcgcttgg
ggctgtgacctatcacatgattatgtaaaaataaactctagccatataagttag

DBGET integrated database retrieval system