KEGG   Acetoanaerobium sticklandii: CLOST_0774Help
Entry
CLOST_0774        CDS       T01334                                 

Gene name
ydjJ
Definition
(GenBank) putative iditol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00040  Pentose and glucuronate interconversions
cst00051  Fructose and mannose metabolism
cst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLOST_0774 (ydjJ)
   00051 Fructose and mannose metabolism
    CLOST_0774 (ydjJ)
Enzymes [BR:cst01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CLOST_0774 (ydjJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBH20900
UniProt: E3PWT5
LinkDB All DBs
Position
907059..908099
Genome map
AA seq 346 aa AA seqDB search
MENKAIFMHGTNDMIWKEIPVPEIGEEDVLIKVEAVGICGSDMHYYQHGKIGGFIVDGDF
ILGHEAAGKVVEVGAKVKDLKVGDRVAMEPGVTCGKCEFCVTGKYNLCPDVEFFATPPYH
GVFANYVKHPASKCFKLPEHVSSIEGALVEPLNVGLHAANQGNVKLGDTVVVFGTGCIGL
CSLLASKAMGASQIIVVDILQNRLDKAKELGATHVINAKNEDVVAKVMELTNNLGAEVVI
ETAGSEITLKQTVDVLKPAGTIVSVGMTPKDSIEFNFMKLQSKEGTIKSVFRYRNLYPTG
INAIASGSIKIADIVSHKFDFEKTKEAFDYVAENPGEVVKAVIVMQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaagcgatatttatgcacggaacaaatgacatgatttggaaagaaattcct
gttcctgaaataggggaagaggatgtattgataaaggttgaagcagttggaatatgtggt
tcagatatgcactattatcagcatggtaaaataggaggctttattgtagatggggacttc
atacttgggcacgaagcagcaggaaaagtagttgaagttggagcaaaagtaaaggattta
aaagttggagatagagttgctatggagccaggagtaacttgcggaaaatgtgaattttgc
gttactggcaagtataatctatgcccagatgtggaattcttcgccacacctccatatcat
ggagtatttgcaaattatgtaaagcacccagcttctaaatgtttcaagcttcctgagcat
gtcagctcaattgaaggagctttagtagagcctttaaacgtagggcttcatgcggctaat
caaggaaatgtaaaattaggagatactgttgtagtgtttggaacaggctgtataggtctt
tgctcgctactagcttcaaaagctatgggagcatctcagattatagttgtagatattttg
caaaatagattggataaagccaaagaattaggagctactcatgtaattaatgcaaagaat
gaagatgtagtagctaaggtaatggagcttacaaataatcttggagctgaagttgtgatt
gaaactgctggctctgaaattacattaaaacagacagtagatgttttaaaaccagctgga
actattgtatctgttgggatgactccaaaggattcaattgaatttaattttatgaaacta
caatcaaaagaaggaactattaaaagcgtatttagatacagaaatttatatcctacaggc
attaatgctattgcaagtggctctataaaaatagctgatattgtaagtcataagtttgac
tttgaaaaaacaaaggaagcatttgattatgtagcagaaaatccaggagaggttgtcaaa
gcagtaatagtgatgcagtag

DBGET integrated database retrieval system