KEGG   Acetoanaerobium sticklandii: CLOST_0933Help
Entry
CLOST_0933        CDS       T01334                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00473  D-Alanine metabolism
cst00550  Peptidoglycan biosynthesis
cst01100  Metabolic pathways
cst01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLOST_0933 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLOST_0933 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CLOST_0933 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cst01011]
    CLOST_0933 (ddlA)
Enzymes [BR:cst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CLOST_0933 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cst01011]
 Precursor biosynthesis
  Amino acid ligase
   CLOST_0933 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CBH21058
UniProt: E3PX93
LinkDB All DBs
Position
1070707..1071627
Genome map
AA seq 306 aa AA seqDB search
MNIGLIFGGKSAEYEVSLQSAMHIYKRLNKDVHNVYLIGMDRDGFMHYFDGSIEEVSDGS
WFDKKTSAEVILYSNKKKPGIYDNDKVIAELELVFPVLHGPYGEDGKLQGLLELSGIPYV
GCSVLASANGMDKDMAKKIFSYEGINQVPHITCYSYEQTQEIVSRAEANLGYPCFIKPAN
MGSSVGISKAKDKQQLVLAMQKAFEYDHKIIIEKGVNAREIEVAVLGNCDNIRISVAGEI
IPSDEFYDYDAKYKSNASQLIIPADLSFEADRQIQDMAYRAYKGLNAEGLCRIRFFCRQG
YSKGVS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacattggattaatatttggtggaaaatctgcagagtatgaagtttcacttcagtct
gcaatgcatatttacaaaagacttaataaggatgttcataatgtatatctcataggaatg
gacagagatggttttatgcattactttgatggaagcatcgaagaggtttcagatggaagc
tggttcgataaaaaaacttcagctgaagtgattttatatagtaacaagaaaaaaccagga
atttatgataatgataaagtgattgctgagcttgagcttgtttttccagttcttcatgga
ccatatggtgaagatggaaagcttcaaggtttactagagctttctggtataccatacgta
ggatgttcagtcctagcatctgctaacggaatggataaggatatggcgaagaaaatattc
tcgtatgaagggataaaccaagtacctcatataacttgctattcatatgagcaaacacaa
gagattgtttcaagagcagaagccaatttagggtatccttgttttattaaaccagccaat
atgggatcaagtgttggaatatcaaaagctaaagataaacaacagctggttttagctatg
caaaaagcttttgagtatgatcataaaataataattgaaaaaggtgttaatgcaagagaa
atagaagttgcagtgctaggcaattgcgataatattagaatatcagttgctggagagata
attccttcagatgagttttacgattatgatgctaagtacaaaagcaatgcatctcagctt
atcataccagcagaccttagttttgaagctgatagacagattcaagacatggcatataga
gcatataaaggcttaaatgcagagggactttgcagaataagatttttttgtagacaagga
tactcaaaaggtgtatcttaa

DBGET integrated database retrieval system