KEGG   Acetoanaerobium sticklandii: CLOST_2039Help
Entry
CLOST_2039        CDS       T01334                                 

Gene name
megL
Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00270  Cysteine and methionine metabolism
cst00450  Selenocompound metabolism
cst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CLOST_2039 (megL)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CLOST_2039 (megL)
Enzymes [BR:cst01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     CLOST_2039 (megL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase Aminotran_1_2 Aminotran_5 GDC-P DegT_DnrJ_EryC1 SelA Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBH22159
UniProt: E3PTF5
LinkDB All DBs
Position
complement(2167834..2169033)
Genome map
AA seq 399 aa AA seqDB search
MNKDALKNMGFATRTIHGGYQKNEMGALATPIYQTSTFIFDSADQGGKRFAGEEEGYIYT
RLGNPSNTPVEEKLALLEGAEACMSMGSGMGAISSALWTALKAGDHVVAADTLYGCTFAL
LSHGMPRYGVEVTFVDTKDPQNVKNAMKPNTKVVYLETPANPTLDVADIRAISDIAHQNE
GCLVMVDNTFCTPYIQRPIELGADVVVHSATKYLNGHGDVIAGFVVGTKAFIDQVRFFGV
KDMTGAVLSPFDAFLIARGMKTLHIRMEKHCENAVKVAEFLRNHPAVDKVYFPGFEDFPQ
AEIVKKQMSLPGAMIAFEIKGDIEKGKKVMDTVHLCVLAVSLGDAETLIQHPASMTHSPY
TAEERAKAGISDGLIRLSVGLENPEDIIADLKQALDGIL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagatgctttaaagaatatgggatttgctacaagaactatacatggtggatat
cagaaaaatgaaatgggagctttagctactcctatataccaaacttctacatttattttc
gacagcgcagaccaaggtggaaaacgttttgctggagaagaagaaggttacatatacaca
agattaggaaatccaagtaatactcctgtagaagaaaagctagcacttttagaaggagca
gaggcatgtatgtcaatgggctctggaatgggagcaatcagttcagctctttggacggct
cttaaggcaggggatcacgtagttgcagcagatacactttatggctgtacttttgctctt
cttagccatggtatgcctagatacggagtagaggttactttcgtagatactaaggatcct
caaaatgttaagaacgcaatgaagccaaatacaaaggtagtttatttagaaacaccagca
aaccctactttagatgtagctgatataagagcaataagcgatatagctcaccagaatgaa
gggtgcttagtaatggttgacaatacattctgtacaccatatattcaaagaccaatagag
ctaggagcagatgttgtagttcactcagcgactaaatatcttaatggacatggagatgta
atagcaggattcgtagtaggaaccaaagcttttatagatcaagtgagattttttggagta
aaagatatgactggagcagttcttagtccatttgatgctttccttatagctagaggtatg
aaaactcttcatatccgtatggagaagcactgtgaaaatgcagtgaaagttgctgagttt
ttacgtaatcatcctgcagtagataaagtatacttcccaggttttgaagatttcccacaa
gctgaaatagttaaaaaacaaatgagtcttccaggagcaatgattgcttttgaaataaaa
ggagatatcgaaaagggtaaaaaggttatggacactgttcatctttgcgtacttgctgta
agcttaggagacgcagaaacattgattcagcatccagcatctatgactcactctccatat
acagcagaagaaagagcaaaagcgggaataagcgatggattaatcagactttctgtaggc
ttagagaatcctgaagatataattgcagatttaaagcaagccttagatggtattttataa

DBGET integrated database retrieval system