KEGG   Acetoanaerobium sticklandii: CLOST_2112Help
Entry
CLOST_2112        CDS       T01334                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst00473  D-Alanine metabolism
cst01100  Metabolic pathways
cst01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLOST_2112
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CLOST_2112
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cst01011]
    CLOST_2112
Enzymes [BR:cst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLOST_2112
Peptidoglycan biosynthesis and degradation proteins [BR:cst01011]
 Precursor biosynthesis
  Racemase
   CLOST_2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Orn_Arg_deC_N
Motif
Other DBs
NCBI-ProteinID: CBH22232
UniProt: E3PTM8
LinkDB All DBs
Position
complement(2246859..2248013)
Genome map
AA seq 384 aa AA seqDB search
MSHTFRPTWAEINLDHVKANYNNIRKLLKPETKFCAVIKANAYGHGAVQYAKVLDKEGAD
YFAVAVCEEALELRQNSITKPIMCLGYVPEDRFKDMMQNNVDITIYSYEKAALLSQIAKD
NNLNAKIHIKLDSGMSRLGLQCDNEAVDEILKISTLENLEIVGIFTHFALADDKDLSYTH
EQYKNYSFVVNELETKGLKIPIKHVCNSAATMMLPEYHLDMVRPGIILYGHYPSDDVDKS
KVKLYPAMALKSTVAHVKKLEEGRGISYGHKYRSKENEIIATIPIGYADGFTRMLSGQAD
VKLNDKMVPVVGRICMDQCMLSLEEEAKVGDQITIFSDEEGMDIERFAQRLGTINYELLC
MVQRRVPRIYKEDGKIIKVQDYLI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccatacatttagaccgacatgggcagaaatcaatctagaccatgtgaaagcaaat
tataataatataaggaaattgcttaaacccgagacgaaattttgtgcagtaatcaaagcg
aatgcttatggacatggagctgtgcagtatgcaaaggttttagataaagaaggagcagat
tattttgctgttgcagtttgtgaagaagctttagagctaagacaaaatagcatcactaag
cctataatgtgcctaggctatgttccagaggacaggtttaaggatatgatgcaaaacaat
gtagacatcacaatctacagctatgaaaaagctgctttattatctcaaatagccaaagat
aataatctaaatgcaaaaatacatattaagctagacagcggtatgtctagacttgggctt
caatgtgataatgaagcagtagatgaaatacttaagatatcaaccttagaaaatttagaa
atagttggcattttcacacattttgcactagcagatgacaaagatttaagctatactcat
gagcagtataagaattacagcttcgttgtaaatgagttagagactaaaggacttaaaatt
ccaataaaacacgtttgcaacagcgctgcaactatgatgctaccagagtatcatctagat
atggtaagacctggaataatactttatggtcattatccatcagatgatgtagataaatca
aaagtaaagctatatccagcaatggcacttaaaagcacggttgctcatgtaaaaaaattg
gaagagggcagagggataagctatggtcataaatatcgctctaaggaaaatgaaataata
gcaacgattcctataggatatgcggatggatttaccagaatgttatctggacaagctgat
gtaaaactaaatgataaaatggtgccagtagttgggcgtatctgtatggaccagtgcatg
ctttcattggaagaagaggccaaggtaggagaccagattactatattttcggatgaagag
ggtatggatatcgaacgttttgcgcaaagactagggaccataaactatgagctactgtgt
atggtacagcgcagagtgcctagaatatataaagaagatggaaagattatcaaggtacaa
gattatctgatttag

DBGET integrated database retrieval system