KEGG   Corynebacterium stationis: CSTAT_02385Help
Entry
CSTAT_02385       CDS       T04724                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csta  Corynebacterium stationis
Pathway
csta00620  Pyruvate metabolism
csta00680  Methane metabolism
csta01100  Metabolic pathways
csta01120  Microbial metabolism in diverse environments
csta01200  Carbon metabolism
Module
csta_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:csta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSTAT_02385
  09102 Energy metabolism
   00680 Methane metabolism
    CSTAT_02385
Enzymes [BR:csta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CSTAT_02385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: APT94238
LinkDB All DBs
Position
complement(483767..486526)
Genome map
AA seq 919 aa AA seqDB search
MSEQVRDDIRLLGRILGRVIAEQEGEDVFELVESTRRLAFGVARGEEKAEALLATFRTID
ENRINLVARSFSHFALMANIAEDLDDETALAAREDAGAQAPDASLHGVLGKLKAAKDIKT
SDVTRILDAAQVSPVFTAHPTETRRRTVFDVQERIVALLRERHSILAQPQTARLEARLAE
IEREAHLRMTILWQTALIRIARPQIEDEVNVGLRYFKRSLLEQVPAINRDTIAGLRDVFG
ASVPNRQVVRTGSWIGGDHDGNPYVTGDTLTYATRQAADTILEYYVDELAALEKELSLSD
RYSESSAELQELATRGRNDIPSRVDEPYRRAIHGVHGRMVATRAAVAGEAAAESGEFSPY
ASPTQFRADLQVIDRSLRQFNDAIIADDRLLRILSAVDTFGFHLNALDLRQNSESFEAVL
DELFAAAGVTATDAGYASLDESAKRELLVAELTSARPLVFPWSQDFSADTERELGIFRAA
AQAVELLGPGVVPHCIVSMTGTVSDILEPMVLLKEVGIISFNPAQQRLVGSVDIAPLFET
IEDLKAGAEILQELWEVDLYRGYLRGREDVQEVVLGYSDSNKDGGYLSANWALYDAQLAI
VKACDTHGIGLRFSHGRGGAVGRGGGPTYDAILAQPEGAVRGSVRITEQGEVISARYGTA
STARRHLEAFVAGTLEASLLDTEKLKEPERAYGIMRDIASLAGEKYAQLVRDDSGFIDYF
TQSTPLHEIGDLNMGSRPTARKQTESIGDLRAIPWVLSWSQSRVNLPGWFGVGTGIMRWA
GEDETRWQDLRKLYQAWPFFRSVLDNMAQVMGKASMNLAQIYSTLVDDSAVSQRVFNTIL
DEYELTKEVFFRITGHDSLMAGNERLERSVQRRYPYLLPLNAIQIELLRRYRAGEDTFLV
SKTIQVTMNGLATGLRTSG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggtgcgcgatgatatccgactgctaggacgcatcctcggccgagtaatt
gccgagcaagaaggcgaagatgtatttgagttggtggaaagcactcgccgcttggccttc
ggggtggcgcgcggtgaggaaaaagctgaggccttgctggcgaccttccggactatcgat
gaaaaccgcatcaacctcgttgcgcgttctttcagccactttgcgctgatggcgaatatc
gcagaggacctcgacgatgaaacggcgcttgcagcccgcgaggatgctggtgcacaggct
cccgatgcttccctgcatggggttttgggcaagctcaaggcggcgaaagacatcaaaaca
agtgatgtcacccgtatcttggatgccgcgcaagtctcccctgtttttaccgcacacccc
acggagacacggcgtcgtacggtatttgatgtccaggagcgcatcgtggcgctattgcgt
gagcgccacagcatcttggcccaaccgcaaacagcacggcttgaagcccgtcttgctgag
attgaacgcgaggctcacctgcgcatgaccatcctgtggcaaaccgcgttaattcgcatt
gcacggccacagatcgaagatgaagtaaacgtaggtctgcgctacttcaagcgcagcctc
ttagagcaggtgccggcgattaaccgcgacaccatcgccgggcttcgcgatgtcttcggc
gcatcagtgcccaaccggcaagttgtgcgcacagggtcatggatcggcggcgaccacgat
ggcaatccttatgtcaccggcgatactttgacctacgcgacgcgacaggccgcggatacc
atcctggaatactacgttgatgagctcgcagcactagaaaaagaactgagcttatcagac
cgctattcagaaagttccgcggaattacaagaactggccacgcgcgggagaaacgatatt
ccaagccgcgtcgatgagccttaccgcagggcaatccacggagtgcacggacgcatggta
gctacccgcgcagccgttgcaggagaagccgcagctgagtctggggaattttcaccttat
gcctccccgacccagtttcgcgcggatttgcaggttattgaccggtctttgcggcaattt
aatgatgcgatcatcgccgacgataggctgctgcgaattctttctgccgtggatactttt
ggcttccacctcaatgctttggatctgcgtcagaactcggagtctttcgaggccgtcttg
gacgaacttttcgctgccgcgggcgttactgcaacagatgccggctacgccagcctggat
gagagcgccaagcgtgaactactagtagctgagctcacctctgctcgcccactggtcttc
ccgtggtcacaagacttcagtgcagacacggaacgcgaactagggatcttccgggcagca
gcccaggccgtcgagttactggggccaggtgttgtcccgcactgcattgtttcaatgacc
ggtacagtcagcgatattttggaaccgatggtactgctcaaagaagtaggcatcataagc
tttaacccagcccagcaacgcctcgtgggttcagtggacatcgcaccgctttttgaaacc
attgaagacttgaaggctggcgcggagatccttcaagaactatgggaagttgacctttac
cgcggatacttgcgcgggcgcgaagacgtccaagaagtcgtgttggggtattccgactcc
aataaagacggcgggtatttgtctgcgaattgggctttatatgatgcgcagctagccatc
gtcaaggcctgcgatacgcacggcatcgggttgcgcttttcacatggccgcggcggtgct
gtgggtcgcggtggcgggccgacgtacgatgccatcttggcccagcctgaaggtgcggtc
cggggcagcgtgcgtattaccgagcaaggtgaggtcatctctgcccgctacggcacagcg
agtaccgcgcgccgccacctggaagcttttgtcgcgggcacgctagaagcctctctactg
gatactgaaaagctaaaagagcctgaacgcgcctatggcatcatgcgggatatcgcctcg
ctggccggtgagaaatatgcgcaattggtgcgcgatgactccgggtttatcgactacttc
acgcaatccacgccattgcacgaaattggcgacctcaatatgggatcacgcccaactgct
cgcaagcagaccgaatccatcggtgacttgcgcgcgattccatgggtcctgtcatggtcg
cagtcgcgcgttaacctgccgggctggttcggagtgggcacaggcatcatgcgctgggct
ggcgaagacgagacccgctggcaagatttgcgcaagctttatcaggcatggccgttcttt
cgttccgtgctcgacaacatggcgcaggtcatggggaaagcgtcgatgaatctcgcacag
atctactccacgcttgtcgatgattccgccgtatcccagcgcgtgtttaacaccatcctg
gacgaatacgaattaaccaaagaggtattcttccgcatcactggtcatgattcgctcatg
gctggtaatgagcgtttggagcgttcagtacagcgacgctatccatacttactgccgctc
aacgccatccagattgagttgctgcgccgctaccgcgcgggcgaggatacattcttggtc
tctaagaccatccaggtgaccatgaacgggcttgcgacaggtctacgcacctcaggctag

DBGET integrated database retrieval system