KEGG   Corynebacterium stationis: CSTAT_03615Help
Entry
CSTAT_03615       CDS       T04724                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
csta  Corynebacterium stationis
Pathway
csta00250  Alanine, aspartate and glutamate metabolism
csta00280  Valine, leucine and isoleucine degradation
csta00410  beta-Alanine metabolism
csta00640  Propanoate metabolism
csta00650  Butanoate metabolism
csta01100  Metabolic pathways
csta01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSTAT_03615
   00650 Butanoate metabolism
    CSTAT_03615
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSTAT_03615
   00280 Valine, leucine and isoleucine degradation
    CSTAT_03615
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSTAT_03615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csta01007]
    CSTAT_03615
Enzymes [BR:csta01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CSTAT_03615
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CSTAT_03615
Amino acid related enzymes [BR:csta01007]
 Aminotransferase (transaminase)
  Class III
   CSTAT_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APT94461
LinkDB All DBs
Position
744207..745520
Genome map
AA seq 437 aa AA seqDB search
MKDFDYHLPQERRVVTDGMGEKSAAINARREAAIARALTPGLPGYVVAADGGVLVDADDN
SYIDFASGIAVTSVGASNKRVADAVAKAAAQFTHTCFMVSPYESYVAVCEKLNQLTPGDH
EKKSVLLNSGAEAVENAVKIARKYTGKNAVAVFDYGYHGRTNLTMSMTAKNKPYKTGFGS
LASDVHRVPMSYPARDGLKGDQAAARAIKVLDQQVGPENLACVVIEPVQGEGGFIVPAEG
FLPAIAQWCRDNDVVFIADEIQSGFGRTGQWFASENEQVIPDLVTTAKGIAAGMPLSGVT
GRAEIMDSPIPGSLGGTYGGNPVACAAALAAIEEFETHDLPGRAREIEAIVREYFEPLLE
LESVLDVRGRGAMMAIELINGEVTNEIAAACKKQGILILTCGLDGNVIRLLPALTIPEHL
LREGLEILTTEIREALA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttcgattaccacctgccgcaggagcgtcgagtagtcactgatggaatggga
gaaaagagcgctgcgattaatgcgcgccgagaggcagccattgcccgtgccctgacccca
ggtctgcctggatatgtcgttgctgcagatggtggtgtcctggttgatgcagatgacaac
tcatacatcgatttcgcatccggcattgctgtgacgtccgttggtgcttccaataagcga
gttgcagatgctgtggctaaggccgccgcacaatttacccacacctgtttcatggtctcc
ccatatgagtcctacgtggcggtgtgtgaaaagctgaaccagctcacccccggtgaccat
gagaagaaatctgttcttcttaactccggtgctgaggcagtagaaaacgcggtcaagatt
gcccgcaagtacaccggcaagaatgccgtggcagtatttgattacggctaccacggtcgc
accaacctgaccatgtccatgacggctaagaacaagccttacaagaccggttttggcagc
ttggcttccgatgttcaccgcgtaccaatgtcatacccagcgcgtgatggcttgaagggt
gatcaggctgctgcacgtgcaatcaaggtgctggaccagcaggttggacctgaaaacctg
gcgtgtgttgttatcgagccagttcagggtgagggcggtttcatcgttcctgctgaaggc
ttcttgccggcgattgcgcagtggtgtcgtgacaacgatgttgtcttcatcgctgatgaa
attcagtccggcttcggccgcactggacagtggttcgcgtctgagaatgagcaggtcatc
ccagacctggtaaccaccgctaagggtattgctgctggtatgcccctatctggtgtgact
ggccgtgcggaaatcatggacagcccaatcccaggttctttgggcggtacctacggcggc
aacccagttgcttgtgccgcagcgctcgctgccatcgaagaattcgagacccatgatctt
ccaggtcgcgcacgcgaaatcgaagcaatcgttcgcgagtactttgagccattgctcgag
ctggaatccgtcctggatgtccgcggacgtggcgccatgatggctattgagctcattaac
ggtgaggtcaccaatgaaattgctgctgcatgtaagaagcagggcatcctcatcttgacc
tgtggtctggacggcaacgtcattcgtttgctgcctgcgttgaccatcccggagcacctg
ctgcgtgaaggtctggaaatccttaccacggaaatccgcgaggctctcgcctaa

DBGET integrated database retrieval system