KEGG   Corynebacterium stationis: CSTAT_12995Help
Entry
CSTAT_12995       CDS       T04724                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
csta  Corynebacterium stationis
Pathway
csta00010  Glycolysis / Gluconeogenesis
csta00071  Fatty acid degradation
csta00350  Tyrosine metabolism
csta00625  Chloroalkane and chloroalkene degradation
csta00626  Naphthalene degradation
csta01100  Metabolic pathways
csta01110  Biosynthesis of secondary metabolites
csta01120  Microbial metabolism in diverse environments
csta01130  Biosynthesis of antibiotics
csta01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSTAT_12995
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSTAT_12995
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CSTAT_12995
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CSTAT_12995
   00626 Naphthalene degradation
    CSTAT_12995
Enzymes [BR:csta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CSTAT_12995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APT96135
LinkDB All DBs
Position
2775003..2776040
Genome map
AA seq 345 aa AA seqDB search
MSAAESQTFNAAVVEKFGQEVTVKEIGLPQPGPNQALVKVLTSGIFHTDLHALEGDWPVK
PEPPFVPGHEGVGEVVELGPGEHDVNVGDIVGNAWSWSARGTCEFCITGRETHCPDAEYG
GYTQNGSFGEHMLVDTRYAARIPEGVDYLEAAPILCAGVTVYKALKQSEARPGQFMVISG
IGGLGHIAVQYAVAMGLRVIAVDIATEKLDLASRLGAEYTVNAGDEDPGSAVQKYTEGGS
HGVLVTAVHEAAFGQALDMARSGGTIVFNGLPPGEFPASVFDIVFRGLTIRGSLVGTRQD
MTEALDFFARGLIKPTVTECSLDDVNDVFERMRNGQIDGRVAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgctgaatcccaaacttttaatgctgctgttgttgaaaaatttggccaggaa
gtcacagtcaaagagattggcctcccacaacctggccccaatcaagcactggttaaggtg
cttacctctggaattttccatacggatctccacgcgcttgagggcgactggccggtaaaa
cctgaaccaccatttgtacctggacatgaaggtgtcggggaagtagtcgaactgggccct
ggggagcatgacgtcaatgttggagacatcgtcggcaacgcttggtcatggtccgctcgt
ggcacttgtgaattctgcattacaggtcgagagacccattgtcccgatgccgaatatgga
ggctatacccagaacggctcctttggcgagcacatgctggtcgacacgcgctatgctgcc
cgcatcccagagggagtcgactacctagaagcagctcccatcctatgcgctggggtgacc
gtctataaagccctcaagcagtccgaggcacgcccaggtcaatttatggtaatttccggc
attggcggcttagggcatattgctgtgcaatacgccgtagcgatgggtctacgtgttatc
gcagtagatattgcaaccgaaaagctagacctagcatctagactcggtgctgaatatacc
gtcaacgcgggtgacgaagatcctggctcagctgtgcagaaatacaccgaaggcggatcc
catggcgtattggttacagcagtccacgaagcagcatttgggcaagcgctggacatggca
cgcagcggcggcacaatcgtcttcaacggcctgccacctggagaatttcctgcatctgta
ttcgacatcgtgttccgaggattaactatccgcggatccctggtaggcactcgacaagat
atgacggaggcgttggacttctttgctcgcggtttaattaaacctaccgttactgaatgc
tcacttgatgatgtcaacgatgtctttgagcgaatgcgtaacggccagatcgacggtcgg
gtagcgatccggtactaa

DBGET integrated database retrieval system