KEGG   Capnocytophaga stomatis: CGC58_00365Help
Entry
CGC58_00365       CDS       T05529                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csto  Capnocytophaga stomatis
Pathway
csto00620  Pyruvate metabolism
csto00680  Methane metabolism
csto01100  Metabolic pathways
csto01120  Microbial metabolism in diverse environments
csto01200  Carbon metabolism
Module
csto_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:csto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGC58_00365
  09102 Energy metabolism
   00680 Methane metabolism
    CGC58_00365
Enzymes [BR:csto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CGC58_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATA88322
UniProt: A0A250FT34
LinkDB All DBs
Position
complement(81249..83813)
Genome map
AA seq 854 aa AA seqDB search
MPRKTKLERFNENVLSKYQIYNGILMTLPYKEVLETGTLLPIFSEMCSKGYEENLSPVEI
VNNFFRKYLENPTEKEKNDLLFRFIQYIERQVVLFDAIEDASFAVVNNMDGLGTLRNVRE
KAESQEKTEQLKAYLRYAKVRPVLTAHPTQFYPGAVLGIINDLSEAIKKDDILLIKNLLA
QLGKTPFFKKEKPTPYDEAVNLIWYLENIFYHSVGAIYKYIYHNIFKDSKIDNEIIELGF
WPGGDRDGNPFVTAEITRKVAERLRRSVIRNYYKDLRNIKRRLTFPEVEPLVNELEIKLY
NLSFLQKDDSISLEEFVEKLKNIKQILVEKYQSLFVEKVEDLLHKIQIFGFHFATLDIRQ
DSRVHHSVVKDIAKTLNGKIFPENYGELSDSEKYECLKNAKGILNSEDFSDELTKQTIES
IYAVKEIQKLNGERGANRYIISNNQSSLNVLEVLTMIRLCDWENPTVDVIPLFETINDLS
VAERVMQELYTNPTYKEHLKNRNDLQIIMLGFSDGTKDGGYLMANWSIYQAKERLTQVAR
NNGVKVIFFDGRGGPPARGGGKAHQFYASLGNTIEAEQIQLTIQGQTISSNFGTLESSQY
NLEQLLSAGINNKVFNDNKSTVLTEEDKKVISELAQVSYESYTDFKNHPMFIPYLERVST
LKYYAKTNIGSRPSKRSQSEGLNFSDLRAIPFVGSWSQLKQNVPGFYGLGTALKYLEEKG
NFDKAIHLYKNSLFFRTLLENSMMSLTKSNFKLTQYMRNDAEFGAFWTLIYEEFELTKKM
LLKLTGYSELMENHQSGKASIEIREKMVLPLLTIQQYALQKIKNEISDSELINIYEKMVM
RSMFGNINASRNSA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaaaaaccaaattagaacgatttaatgaaaatgtactgagtaaatatcagatt
tacaacggtatattaatgacccttccttataaggaagtgctggaaacaggaactttattg
cctatttttagtgagatgtgcagtaaaggatatgaagaaaacttatctccagttgaaata
gttaataattttttccgtaaatatttagaaaacccaactgaaaaagaaaaaaatgattta
ttatttcggtttatacaatatattgaacgtcaggtagttttatttgacgctattgaagat
gccagctttgctgttgtaaacaatatggacgggcttggtacactcagaaatgttcgagaa
aaggctgaatctcaggaaaaaacggaacaattaaaggcatatctgcgttatgccaaggtg
cgtcctgtgcttacagcccatccgacgcagttttatcccggagctgttttgggaattata
aatgatttgtctgaggctattaaaaaagatgatatattgctcattaagaatcttttagct
caattaggaaaaactcctttcttcaaaaaagaaaaaccaactccgtatgatgaagctgtg
aatttgatatggtatttggaaaatattttttatcattccgttggggcgatttataaatat
atatatcataacatatttaaagacagtaagatagataacgaaatcattgaacttgggttc
tggcctggtggtgaccgtgacgggaatccgtttgtaactgcggaaattacacgcaaagta
gcggaacgcctcaggaggtctgttatccgaaactattataaagatttacgaaatattaaa
agaagacttactttccccgaagtagaacctttggttaatgaactggaaatcaagttgtac
aatttaagttttttacagaaagatgattctatttcattggaagaatttgttgaaaaactc
aaaaatattaagcagattttggttgagaaatatcagtcgttatttgttgaaaaagttgaa
gatttattgcataagatacaaatttttgggtttcacttcgcaacacttgatattcgccaa
gattcgcgagtgcatcattccgttgtaaaagatattgctaaaactttaaacggaaaaatt
ttccctgaaaattacggtgaattatctgatagtgagaaatatgaatgtttgaaaaatgca
aaaggaattttgaattctgaggatttttctgatgaactcaccaagcaaaccattgagagt
atttatgctgtgaaagaaatccaaaagcttaatggtgagcgtggggcaaatcgttacata
attagtaacaatcaaagttctttgaatgtacttgaagtgctgacaatgattcgtttatgc
gattgggagaatccaactgtagatgttattcctctttttgaaactattaatgatttgtct
gttgctgagcgtgttatgcaggaattgtacacaaatccaacctataaagaacatcttaaa
aatcgtaatgatttacaaatcattatgttaggtttttctgatggaacaaaagatggcgga
tatttgatggcaaattggagtatttatcaggctaaggaacgtttaacgcaagttgctcga
aataatggagttaaggttatattttttgatggaaggggaggacctcctgcacgtggaggc
gggaaagcacatcagttttacgcatctttaggaaataccattgaggcagaacaaattcag
ctaactattcagggtcagacaattagctctaattttggaactttggaatcttctcaatat
aacttagaacaattgctcagtgcgggaattaataacaaagttttcaatgataacaaaagt
acagtacttactgaagaagataaaaaagtaatttctgaacttgctcaggttagctatgaa
agttataccgattttaaaaatcatccgatgtttattccttatttagagcgagttagcaca
ttgaagtactatgctaaaaccaatattggaagccgtccgagtaagcgttcacaatcggaa
ggattgaatttcagtgatttaagagctattccgtttgtgggaagttggagccagttaaaa
cagaatgttcctggattttacggattaggaactgcattaaaatatctcgaggaaaaagga
aattttgataaggcaattcatttgtataaaaactcattgtttttcaggacattacttgaa
aatagtatgatgagtttaacaaaatcaaatttcaaactgactcaatatatgcgtaatgat
gcagaatttggagcattttggacgctgatttacgaagaatttgaattgaccaaaaaaatg
ttattgaaattaacgggatattcagaattaatggaaaatcatcaaagcggaaaagcatct
atagaaatacgtgaaaaaatggttttgccattgctaacgattcaacagtatgccttacaa
aaaattaagaatgaaatatctgattctgaattaattaatatttacgagaaaatggtaatg
cgttcgatgtttggaaacattaatgcaagccgaaattcagcataa

DBGET integrated database retrieval system