KEGG   Capnocytophaga stomatis: CGC58_05995Help
Entry
CGC58_05995       CDS       T05529                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
csto  Capnocytophaga stomatis
Pathway
csto00240  Pyrimidine metabolism
csto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CGC58_05995
Enzymes [BR:csto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CGC58_05995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ATA89313
UniProt: A0A250FW47
LinkDB All DBs
Position
1325292..1325906
Genome map
AA seq 204 aa AA seqDB search
MFLENTTNHTEKFGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPAFDTRYDEDK
VVSHNATEIHSTPVPAATNILLLADGCDVIGIDEAQFFDDEIVNVCNDLANRGMRVIVAG
LDMDYKGKPFGPMPALMATAEYVTKVHAVCTRTGNLANFSFRKSENENLYMLGEQDTYEP
LSRAVFFKAMKNRNQEATHKKSES
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaatactacaaatcatacagaaaaatttggctggattgaagtcatttgc
ggctcgatgttttccggaaaaacggaagaactcatccgaaggctgcgacgtgcacaattc
gcaaaacaaaaagtagaaattttcaaacctgcttttgacacacgttatgatgaagacaaa
gtagtttctcacaatgccaccgaaattcactcaactccagttcctgcggcaactaatatt
ttattgttggcagatggttgcgatgttatcggcattgatgaagctcaatttttcgatgat
gaaattgtaaatgtttgtaatgacctagcaaacagaggaatgcgtgtaattgttgccgga
ctggatatggattacaaaggaaagcctttcggtccgatgcctgcattaatggcaactgct
gaatatgtaaccaaagtacacgccgtttgcacacgcacggggaatttagcaaactttagt
tttagaaaatctgaaaatgaaaacttgtatatgcttggagaacaggatacttacgaacct
ctgagcagagcggttttcttcaaggcaatgaaaaaccgaaatcaggaagctactcacaaa
aaatcagaatcttaa

DBGET integrated database retrieval system