KEGG   Capnocytophaga stomatis: CGC58_08670Help
Entry
CGC58_08670       CDS       T05529                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
csto  Capnocytophaga stomatis
Pathway
csto00061  Fatty acid biosynthesis
csto00780  Biotin metabolism
csto01100  Metabolic pathways
csto01130  Biosynthesis of antibiotics
csto01212  Fatty acid metabolism
Module
csto_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:csto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CGC58_08670
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CGC58_08670
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CGC58_08670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:csto01004]
    CGC58_08670
Enzymes [BR:csto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CGC58_08670
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CGC58_08670
Lipid biosynthesis proteins [BR:csto01004]
 Fatty acid synthase
  Component type
   CGC58_08670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF1181 Band_7_C
Motif
Other DBs
NCBI-ProteinID: ATA89792
UniProt: A0A250FXB3
LinkDB All DBs
Position
1971623..1972429
Genome map
AA seq 268 aa AA seqDB search
MYNLLKGKRGIIFGALDENSIAWKTAERVHAEGGTFVLTNAPIAMRMGQIKKLAEKTGSE
IIPADATNMDDLQNLVTKAMEILGGKLDFVLHSIGMSVNVRKNIPYTESNYDFTEKGWDV
SALSFHKVCQVLYKNDAMNEWGSIVALTYMAAQRTFPDYNDMADNKAYLESIARSFGYFF
GKEKKVRVNTISQSPTPTTAGQGVKGFDGFISYAEKMSPLGNATAQDCADYTVSLFSDLT
RKVTMQNLFHDGGFSNTGVSQEVIERFS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttattaaaagggaaaagaggaatcatctttggtgcattagatgaaaattcg
atagcttggaaaacagcagagcgtgttcacgccgaaggaggaacattcgtgcttacaaac
gctcctattgcaatgcgaatgggacaaattaagaagttggcagaaaaaacaggttcggaa
attattcctgctgatgctaccaatatggacgatttgcaaaatttggtaaccaaagcaatg
gaaattttgggaggaaaattagactttgtgctacattctatcgggatgtcagttaatgtt
cgcaaaaatatcccatataccgaatcaaactacgattttactgaaaaaggttgggacgtt
tcggctctttcttttcataaagtttgccaagttttgtacaaaaacgacgcaatgaacgaa
tggggaagtattgtagctcttacttatatggctgctcagcgtaccttccccgattacaat
gatatggctgataataaggcgtatttagagtcgattgcacgtagttttgggtatttcttc
gggaaagaaaagaaagtacgagtgaatactatctcacaatcgccaacgccaaccactgca
gggcaaggagttaaaggcttcgacgggtttatttcgtatgctgaaaaaatgtctccttta
ggtaatgccactgctcaggattgtgccgattacaccgtaagtcttttctctgaccttacc
agaaaagttactatgcaaaatcttttccacgacggaggtttttcaaatacgggtgtaagt
caggaagtaattgaaagatttagctaa

DBGET integrated database retrieval system