KEGG   Corynebacterium striatum: CBE89_02040Help
Entry
CBE89_02040       CDS       T05059                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cstr  Corynebacterium striatum
Pathway
cstr00564  Glycerophospholipid metabolism
cstr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cstr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBE89_02040
Enzymes [BR:cstr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CBE89_02040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 Pyr_redox_2 Thi4 GIDA HI0933_like Pyr_redox_3 3HCDH_N Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ART20412
UniProt: A0A2Z2IY33
LinkDB All DBs
Position
396363..398075
Genome map
AA seq 570 aa AA seqDB search
MTTLSNQSFNPEYYEKAWENYSTEEYDVVIIGGGSVGAGAAVDAATRGLKTAVVETRDFA
AGTSSRSSKMFHGGLRYLAMLDFRLVAESLHERELNMSTLAPHLVKPLKFIFPLTHPVWE
RVMMFGGFTLYDLMGGAKSVPMQKHLTRKGVLKVAPGLKDDAVVGGVRYYDTLVDDARHT
MTVLRTAAEFGANVRTGTEVIGFEKDRGGRIIGAHVRDLATGREATINGRVFINATGVWN
DKIQEMAGVEGKFTVHASKGVHIVVPKDALDADAALCFVTEKSVLFVIPWGEYWIIGTTD
TDWEKGLSLPDPAPTKADIDYILDQVNQRVSRTITRSDIVGVYSGLRPLLTGKSDTTTKL
SRNHAVAKVAPGLVSVAGGKYTTYRVIGKDAVDLATKELNFEVPESVTERTPILGAEGYH
ALANQVGALAKRYSLHQDVIEHLLGRYGSLLGEVLAPAEDDPELLKPLPNAEHYLWAEVR
YAVTHEGALHLEDVLSRRLRIAIEYADRGVDSADAVADFITPLLGWDEATKQAEIAAFKE
HTEAELQAEAALTDQEANDILVRAADKPQA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctaagcaatcaaagtttcaatccggagtactacgagaaggcttgggagaac
tattccactgaggaatacgacgttgtcatcatcggcggcggttccgtgggtgcgggtgct
gccgttgacgccgcaacccgtggcctgaagacggcagtagtggagacccgcgatttcgca
gcaggtacctcctcgcgttcctcaaagatgttccacggcggcctgcgctacctggccatg
ctcgacttccgtctcgtagccgagtcactccacgagcgcgagctcaacatgtcgactctc
gcgccgcacctggttaagccactgaaattcatcttcccgctcacccacccagtctgggag
cgcgtcatgatgttcggtggctttactttgtatgacctcatgggcggtgcaaagagcgtt
cctatgcagaagcacctgacccgcaagggcgtgctcaaggttgcgccgggcctgaaggac
gacgctgtcgtgggcggagtgcgctactatgacacgcttgtcgacgacgcccgccacacc
atgaccgttctgcgcaccgccgccgagtttggcgccaacgtgcgcaccggcaccgaggtc
atcggcttcgaaaaggatcgtggcggccgcattatcggtgctcatgttcgcgacctcgca
accggccgcgaggccaccatcaatggccgtgtcttcatcaacgccaccggcgtctggaat
gacaagattcaggaaatggctggcgtggagggcaagttcaccgttcacgcctccaagggc
gtgcacatcgttgtgccgaaggatgccctcgacgctgacgctgccctgtgcttcgtcaca
gaaaagtccgtgctcttcgtcatcccatggggcgagtactggatcatcggtaccaccgac
accgactgggagaagggtctgtccttgccagatccagcaccgaccaaggccgacatcgac
tacatcctagatcaggtcaaccagcgcgtttcccgtactattacccgctccgacatcgtc
ggcgtctactcgggcctgcgcccgctgctcaccggcaagtctgacaccaccaccaagctc
tcgcgtaaccatgctgtggcaaaggtggccccgggcttggtctccgttgcaggcggcaag
tataccacctaccgcgtcatcggtaaggacgccgtggatttggcgaccaaggaactcaac
ttcgaggttccagagtccgtcaccgaacgtaccccgatcctgggtgccgagggttaccat
gcgctggctaaccaggtcggtgccctggcaaagcgctacagcctgcaccaagacgtcatc
gagcacctgctgggccgctacggttccctgctgggcgaggtcctggcccctgcagaggac
gaccctgagctgctcaagccgctgccgaatgcggagcactacctgtgggccgaggtacgc
tacgccgtcacccatgagggcgcactgcacctcgaggacgttctctcccgccgcctgcga
atcgccattgagtacgccgatcgcggcgtcgattccgccgatgcggtggccgacttcatc
acgcctttgctgggttgggatgaggctaccaagcaggcagaaatcgctgcattcaaggag
cacacggaggctgagctccaggctgaggcagcacttaccgatcaagaagcaaacgacatc
ctcgtgcgcgcggcagacaagccgcaggcataa

DBGET integrated database retrieval system