KEGG   Corynebacterium striatum: CBE89_05015Help
Entry
CBE89_05015       CDS       T05059                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cstr  Corynebacterium striatum
Brite
KEGG Orthology (KO) [BR:cstr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cstr01001]
    CBE89_05015
Enzymes [BR:cstr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CBE89_05015
Protein kinases [BR:cstr01001]
 Serine/threonine kinases: Other
  Bacterial family
   CBE89_05015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ART20925
UniProt: A0A2Z2J0E1
LinkDB All DBs
Position
complement(1041929..1043293)
Genome map
AA seq 454 aa AA seqDB search
MTRLEIGDVLEDRYRVDRPIAQGGMSTVYRCVDLRLGRAVAAKVMDERYQDDPAFVKRFE
REARAMAQLQHPNLVAVHDFSSEGVPIYLIMELITGGTLRELLAERGPMPAHAAAAVMHP
MLMGLDEVHRTGLIHRDIKPDNVLITSHNRVKLGDFGLVRSAAAEQASNQIIGTVSYLSP
EQVTGEPITPASDVYSAGVVLFELLTGTVPFSGATPMEHATARLHADVPAPSSRIAGVPK
LFDALVATATACQASERFADAGEFLDALDDVTRDLDLPEFTVPVPRNAAAARTAEQPTDF
SGTGATHVFDATTTIDTPSATPAEHYTAPAPEAATEYIPQTPPADIPHRAPLSFETRADL
PAPPFVAPPVPPVTPRSADYPAPNYHAQAPLEPQPQSALSHIAEDEPAERPVSNRNVFTL
LLFLALVGLATVAVALGGWWFGSGQYGSMPTFFA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggctggaaataggcgacgtactcgaagaccgctatcgagttgatcggccaatc
gcgcaaggcggtatgtccaccgtgtatcgctgcgttgacttgcgcctaggcagagctgtg
gccgccaaggtcatggacgagcgttaccaggacgaccctgcttttgtgaaacgcttcgag
cgggaggcccgcgccatggcgcagctacagcaccccaatctcgttgccgtgcatgacttc
tcttccgagggcgtgcccatctacctcatcatggaactcatcacgggcggcacgttgcgc
gagctgctcgccgagcgcggccccatgcctgcgcatgcggctgccgccgtgatgcaccca
atgctcatgggcctcgacgaggtgcaccgcactggtctgatacaccgcgacattaaaccg
gacaacgtgctcattacctcgcataaccgggtgaagctcggtgactttggcctggtgcgc
tccgcggcggccgagcaggcctcgaaccagatcatcggtacggtgtcctacctctcccct
gagcaagtcacgggcgagccgatcacgcctgcatccgacgtctattctgcgggtgtggtt
ctcttcgagctgctcaccggcaccgtgccgtttagtggcgcgaccccgatggaacacgcg
acagcgcgcctgcacgcggatgttccagcgccgtcgtcacgcattgccggggtgccgaag
cttttcgacgctctcgtggccaccgcaaccgcttgccaagccagcgagcgcttcgccgac
gccggggagttcctcgacgctcttgacgacgtcacacgggaccttgatctgccggagttc
accgttccagttccgcgcaacgctgcggccgcccgcacagctgaacagcccaccgacttc
tcgggaaccggcgccacgcacgtctttgacgcgaccaccactatcgatactccctctgca
acccccgcagagcactacacagcccccgccccagaggcagcgaccgaatacattccgcag
acccctcccgcggatatcccccaccgcgcaccactgagttttgaaactcgcgcggatttg
ccggctccgcccttcgtcgcgccaccagttccacccgtgaccccgcgcagcgcggattat
ccagcacctaactatcacgcgcaggcgccgctggagccccagcctcagagcgcgctgtcg
cacatcgctgaagacgaaccagccgagcgcccagtgagcaaccgcaacgtgttcacgctg
ctgctgttcttggcgctcgttgggctagcaaccgttgccgtcgccttgggtgggtggtgg
tttggctctggccaatacggttctatgccgacattcttcgcctag

DBGET integrated database retrieval system