KEGG   Corynebacterium striatum: CBE89_05825Help
Entry
CBE89_05825       CDS       T05059                                 

Definition
(GenBank) hypothetical protein
Organism
cstr  Corynebacterium striatum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMIN Alpha_GJ
Motif
Other DBs
NCBI-ProteinID: ART21073
UniProt: A0A2Z2IYB5
LinkDB All DBs
Position
complement(1217507..1218220)
Genome map
AA seq 237 aa AA seqDB search
MIPLKLSAPAYSLAHRHRLHVVAAALTTATLTLSACAGSASNDNSHSAPLSTVAPSETTP
PTSSQTIEEITSPQPTSTEQKSDGLPEGFLGTPDTADIDFDGASEGELIPTTLRAGSHQG
YDRVVIEFAGAGIPRWWAHYTESTSAPGSGFPVPYSGNIALEIGLERTPWPDSQELQDAM
LKPNAETPGAGVVRSVEFVSAFEAQSHFVIGLDKKVPYSITYLDGPPRIVIDFLTNS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgattcctctcaagctctctgcgcctgcctattcgcttgctcatcgccaccgcctgcac
gttgtggccgccgccttaaccacggccacgctgacgctttcagcctgcgccggcagtgcc
tccaacgacaacagccacagcgcgccgctatctaccgtggcgccttctgagaccacgccg
ccgacaagcagtcaaacgatcgaggagatcacaagcccgcagccaacgagcaccgaacag
aaatctgatgggcttccagagggcttcttaggcactccagatacggcagacatcgacttc
gacggagcctccgaaggcgaactaatcccaaccactttgcgtgctggtagccatcaaggc
tacgaccgcgttgtcatagagtttgcgggcgccggcattccgcggtggtgggctcactac
accgagtccacaagcgcaccagggtcggggttccccgtgccctactccggcaatatcgct
ctcgaaataggcctcgaacgcacaccgtggcccgatagccaagagctccaagacgcaatg
ctcaagcccaatgccgaaactcctggcgcgggtgtcgtgcgcagcgtggaatttgtcagc
gcattcgaggcgcagtctcatttcgttattggactcgataagaaagtgccctattccatc
acgtacttggacggtccacctcgcattgtcattgacttcctcaccaactcttag

DBGET integrated database retrieval system