KEGG   Corynebacterium striatum: CBE89_07710Help
Entry
CBE89_07710       CDS       T05059                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cstr  Corynebacterium striatum
Pathway
cstr00473  D-Alanine metabolism
cstr00550  Peptidoglycan biosynthesis
cstr01100  Metabolic pathways
cstr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cstr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBE89_07710
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBE89_07710
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CBE89_07710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cstr01011]
    CBE89_07710
Enzymes [BR:cstr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CBE89_07710
Peptidoglycan biosynthesis and degradation proteins [BR:cstr01011]
 Precursor biosynthesis
  Amino acid ligase
   CBE89_07710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp ATP-grasp_4 Ins134_P3_kin RimK
Motif
Other DBs
NCBI-ProteinID: ART21392
UniProt: A0A2Z2J040
LinkDB All DBs
Position
complement(1618811..1619875)
Genome map
AA seq 354 aa AA seqDB search
MSEKIRVAVVYGGRSSEHSVSCISAGAIMKHLDPAKYTVVPIGITKDGQWTPGTMEGLEI
VDGVLPEVTMGDELALSLNPETKGRFHNVTQHSHFEEVDVIIPVLHGPYGEDGTVQGLFE
LSDIPYVGAGVLASSAGMDKEFTKKLLTAEGLLVAPEVILKGRTELSADEKAQLGLPVFV
KPARGGSSIGVSKVSDWAEFSRAVEVAFESDNKVLVEPEIVGAEVEIGVLEYADGTVIAS
VPAQLNGIEEAEEGFYDFDAKYIDEGVSAQIPAPLDTDLIQTLRETAVSAFRALGCEGLS
RVDFFVTKDAFYINEINTFPGFTPISMYPQVLAATGVDYAALLDALIEGAMARA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaagatccgtgtagccgtagtttatggcggccgtagttccgagcattcagtt
tcctgcatttctgcaggcgcgattatgaagcatttggatcccgccaagtatacggtggtg
ccgattggcatcactaaggatggccaatggacgccaggcaccatggaaggccttgagatt
gttgacggcgtgttgccagaggtcactatgggggatgagttggcgctctcccttaatcct
gaaaccaaaggtcgtttccacaacgtgacccagcatagccacttcgaagaagtcgacgtt
attatccccgtgctgcatggtccttatggcgaggatggaaccgtccagggtctattcgag
ctttccgacatcccttacgttggcgccggggtccttgcctcctccgctggcatggataaa
gagttcacgaagaagcttctcactgccgaggggctgctggttgcgccagaggtgattctc
aaaggccgcaccgagctgagcgctgatgagaaggcgcaactgggtctgcctgtattcgta
aagccggcacgcggtggatcgtcgatcggtgtttccaaggtcagcgattgggcagagttc
tcgcgcgccgtcgaggtggcattcgaaagcgacaacaaggtgttggtagaaccggagatc
gtgggcgctgaggtggaaatcggtgtgctcgaatatgcggatggtacggtgatcgcctct
gtgcctgcccagctcaacggcattgaagaagcagaggaaggcttctacgactttgatgct
aagtacattgatgaaggagttagcgcacaaattccggcgcctcttgacacggatctgatt
cagaccttgcgcgaaactgcggtctcagccttccgcgcgctcggctgcgaggggctcagc
cgcgttgacttcttcgtcactaaggatgctttctacattaacgagatcaacacgtttccg
ggattcacaccgatctccatgtacccacaggttcttgcagcgacaggcgtggactacgcc
gcgcttctcgacgccctcatcgaaggcgcgatggcacgcgcataa

DBGET integrated database retrieval system