KEGG   Candidatus Caldiarchaeum subterraneum: CSUB_C0653Help
Entry
CSUB_C0653        CDS       T02904                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K19588  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
csu  Candidatus Caldiarchaeum subterraneum
Pathway
csu00040  Pentose and glucuronate interconversions
csu00053  Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:csu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CSUB_C0653
   00053 Ascorbate and aldarate metabolism
    CSUB_C0653
Enzymes [BR:csu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CSUB_C0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Wtap M157 SMP_LBD
Motif
Other DBs
NCBI-ProteinID: BAJ50512
UniProt: E6N5X7
LinkDB All DBs
Position
620927..622405
Genome map
AA seq 492 aa AA seqDB search
MLVCVVGFMASVYPCIINGERVQAGGLGVFEDRNPADVEEVVAVFPLLSREDAKNAIDSA
EKAFEKWAALSPLQRGKYLVKAAQIMENEAEELARILTREEGKTLNESRAEVARAIDIFR
FYGVMGSRLRGEFTPSTDPRTHLFTLREPLGVVSIITPWNFPIAIPSWKIAPALICGNTV
VFKPASYTPLIGYKIVEALHSAGIPPGVVNFVTGSGGEVGAELIINDKVDAISFTGSAEV
GEEIKQYACRSNIRVQLELGGKNPSVVLEDADLGKAVEMVTRAAFGLTGQACTATSRAIV
VEKIAKQFEEKLVERVKQIRVGNGLADGVEMGPVVGEKELKKILSYVDIGLREGAKLLIG
GKRLTSSEHAKGFFLEPTIFTNVTPDMKIAQEEIFGPVLSIIHVSDFDEAVEVANKIDYG
LSASVFTTSLPRAFEFIHRVQAGVVKVNKPTTGLEFQVPFGGYKRSSYGDIKEQGETALD
FYSKLKTVYLGY
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttggtttgtgtagtcgggtttatggcaagcgtatatccgtgtatcataaatggtgag
cgggttcaggctggtggtttaggtgttttcgaggaccggaacccggcggatgtggaggag
gttgttgctgttttcccgcttctaagcagagaggatgcgaaaaacgccatagactcggcg
gagaaggcttttgagaaatgggccgccctttctcccctacagcgtggaaaatatctcgtc
aaggctgcacaaatcatggagaacgaggcggaggagctggcgaggattctgacgagggaa
gagggtaaaacccttaacgagagcagggctgaggtggcacgcgccatagatattttcagg
ttctacggcgtgatgggcagccgtttgagaggagagttcactccctccaccgacccacgg
acacatctattcaccctgagagaacccctcggtgttgtctcgataataacgccatggaac
ttccccatagccataccgtcttggaaaattgcgccagcacttatctgcggaaacacggtg
gttttcaagccggcaagctacactccgctgataggctacaagatagtcgaggctcttcac
tccgcgggcataccgcctggtgtggtgaactttgtcacaggctcgggtggcgaggttggg
gcggaactcattataaacgataaagttgacgcaatctctttcacaggctcggccgaggtt
ggggaggaaatcaagcaatacgcctgcaggtcaaacatacgtgttcagctggagctcggc
ggcaaaaacccctcggttgttctcgaggatgctgacctaggtaaagctgtggagatggtt
actagggccgctttcgggttgactggccaagcatgcacagccaccagcagggcaattgtt
gtcgagaaaatcgctaaacaatttgaggagaagctggttgaacgcgttaagcagatacgt
gtgggtaacgggttggctgatggtgtggagatgggccccgtggtaggcgaaaaagagctg
aagaaaatcctctcatacgtggacatcggtcttcgagagggggccaaactcctcatcgga
ggaaaaagactaacttcgtcagagcacgcgaaggggttcttcctcgagccgacaatattc
accaacgtcacacccgacatgaagatagcgcaagaagaaatattcggacccgttttatcc
atcatacatgtgagtgactttgacgaggctgtggaggttgcgaacaaaattgactatgga
ttgtccgcctccgtgtttacaacgagtttgccacgggccttcgaattcattcaccgtgta
caagcaggtgttgtgaaggtcaacaagccgacgaccggactcgagtttcaggtgcctttc
ggaggatacaaaaggtcaagctatggcgacataaaggagcagggagaaactgctctggac
ttctactccaagctcaagactgtttacctcggctactga

DBGET integrated database retrieval system