KEGG   Cucumis sativus (cucumber): 101202756Help
Entry
101202756         CDS       T02486                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00010  Glycolysis / Gluconeogenesis
csv00053  Ascorbate and aldarate metabolism
csv00071  Fatty acid degradation
csv00280  Valine, leucine and isoleucine degradation
csv00310  Lysine degradation
csv00330  Arginine and proline metabolism
csv00340  Histidine metabolism
csv00380  Tryptophan metabolism
csv00410  beta-Alanine metabolism
csv00561  Glycerolipid metabolism
csv00620  Pyruvate metabolism
csv00903  Limonene and pinene degradation
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101202756
   00053 Ascorbate and aldarate metabolism
    101202756
   00620 Pyruvate metabolism
    101202756
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101202756
   00561 Glycerolipid metabolism
    101202756
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101202756
   00310 Lysine degradation
    101202756
   00330 Arginine and proline metabolism
    101202756
   00340 Histidine metabolism
    101202756
   00380 Tryptophan metabolism
    101202756
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101202756
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    101202756
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101202756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 DtxR
Motif
Other DBs
NCBI-GeneID: 101202756
NCBI-ProteinID: XP_011648752
LinkDB All DBs
Position
2
AA seq 537 aa AA seqDB search
MASRRISSLLSRSISSSSSSSSSSSSSSCLNGRTIAKYSTASAVEDPITPSVKVNYNQLL
INGQFVDSVSGKTFPTLDPRTGEVIAEVAEGDARDIDIAVSAARKAFDEGPWPKMTAYER
SKIMLRFADLVEKHAEEVAALETWDNGKTYEQSLKIEIPMFVRLFRYYGGWADKIHGLTV
PADGSYHVQTLHEPIGVAGQIIPWNFPLVMFAWKVGPALACGNTIVLKTAEQTPLSALLV
AKLFHEAGLPEGVLNIVSGYGPTAGAALASHMEVDKLAFTGSTETGKVVLELASKSNLKP
VTLELGGKSPFIVCEDADVDKAVEMAHFALFFNQGQCCCAGSRTFVHEKVHDEFVEKARN
RAANRVVGDPFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKGYYVQPT
VFSNVKDDMKIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINTANRLTR
SLRVGSVWINCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENPAWL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaggaggatatcctcactcttatctcgttccatttcttcttcttcttcttct
tcttcttcttcttcttcttcttcttgtttgaatggaagaacaattgctaaatatagtact
gcatctgctgttgaagatcctatcactccatctgtgaaagtgaattataaccagttattg
attaatgggcagtttgtggattcagtctcaggaaaaacgtttcctactttggatccaaga
actggggaagtcattgctgaagttgctgaaggtgatgctagagatattgatattgcagtt
tctgctgcacgcaaggcgtttgatgaagggccttggcctaaaatgactgcttatgaaagg
tcaaagataatgttgaggtttgctgatttggttgaaaagcatgctgaagaagttgcagca
ctcgaaacatgggataatggaaagacatatgaacaatcgttaaaaattgaaatcccgatg
ttcgtacgtctctttcgatactatggtggatgggcggataagatccacggactcacagtt
cctgccgatggctcgtatcatgtacaaaccttgcacgaacctattggcgtggcaggtcag
atcattccatggaactttcctctggtcatgtttgcttggaaagtcggtccggcattagca
tgtgggaatactattgttctgaagacagctgagcaaacacctttgtctgctctattggtg
gctaagctattccatgaggctggacttcctgagggcgttttgaatattgtttctggttat
ggacctactgctggtgctgcccttgctagtcatatggaagttgataaacttgcttttact
ggatcaaccgaaacggggaaggttgtacttgaattagcatcaaaaagcaatctgaagcca
gtaacgttggagcttggtggaaaatcccctttcattgtatgtgaggatgctgatgtagac
aaggctgtggaaatggcacactttgctctgttcttcaaccagggacaatgttgctgtgct
ggttctcgtactttcgttcatgaaaaagtacacgatgagtttgtagaaaaagcaaggaac
cgagctgcgaaccgtgttgttggtgatcctttcttaggtggaatcgagcaaggtcctcag
gttgatgccgaacaattcaagaaaatattgaaatatataaaatatgggattgaaggtgga
gccactcttgaagcaggaggagataggtttggttccaagggttactatgtccaaccaaca
gttttctcaaacgtcaaggatgacatgaaaattgcagaggatgagatttttggtccagta
caaacaatcctaaaatacaaagacattgatgaggtgataaggagggcaaatgctagtcgt
tatggactggctgctggtgtgtttactcaaaacatcaacactgccaaccggttgacacgc
tcgctgagagttgggtcagtatggatcaattgctttgatgtatttgatgctgcagttcct
tttggtgggtacaagatgagtggacatgggagagaaaagggaatttacagccttagcaat
tacctgcaagtaaaggctgtggtgactcctttggaaaaccctgcttggctttag

DBGET integrated database retrieval system