KEGG   Cucumis sativus (cucumber): 101203813Help
Entry
101203813         CDS       T02486                                 

Definition
(RefSeq) uncharacterized protein DDB_G0290685
  KO
K23573  dentin sialophosphoprotein
Organism
csv  Cucumis sativus (cucumber)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 101203813
NCBI-ProteinID: XP_011657915
UniProt: A0A0A0KLL8
LinkDB All DBs
Position
6
AA seq 939 aa AA seqDB search
MFRSSPRRSQRSKGFKVKHALQIFILLGVCVWLVYQVQHSRGKKATFNESTKLDEVVKLG
RKDLHPRVDENITRDESHREDEEETRSELEKGMSGSDNEEKGGGNDEFHDQQEVQEDTEN
KDFVVDIEKEREENSEVRKETETEENKEIENENKENEEIKENDKENGEIQKSQSDENGEE
GRGGGIEENVNEESKEHGNQEVNGNEESKGQENQDVNGNNESKGQENQDQNGNEESKIQE
NQDVNGNNESKGQENQDQNGNEESKIQENQDVNGNNESKGQENQDQNGNEESKIQENQDV
NGNNESKGQENQDQNGNEESKIQENQDVNGNNESKGQENQDQNGNEESKIQENQDVNGNN
ESKGQENQDQNGNEESKIQENQDVNGNNESKGQENQDQNGNEESKIQENQDVNGNNESKG
QENQDQNGNEESKIQENQDVNGNEESKEHGNQEVNGNEESKIQENQDVNGNEESKEHGNQ
EVNGNEESKIQENQDVNGSEESKGLENQEVNGNEGSKGLENQEGNGNEESKEKGNQEENE
GKDKVNEMPTEDRKENENEERSQSNESGMGEKNEENKENENREERIIEETDKKDSNNGGE
REKESGDNEKEETKEKDREDVNVETKEAISETKEGSQDTMENNGNENKEENNENETVKKD
EQKEVSIKSVVPAEEQVQDGNDKSNNDAREAQYKGDNASSAVHEDQNTATGNGQDGFAKL
NEVESVENKENYESQHKDAQTIREDVDSDRNEPVQNGSEAEKNGNNQSEVPEEVTNNNEE
QPVSKENDQHDSVSQESNTSEPDQSDRQVSHNENENAVHSNSNDDSSGQKNDHDNPTDMS
NSQENDASSNTIEGAGAGRHDNENVDQSNGNNSDHTKENFDSHNEGVRFSDTKSSEDQGN
TGDSSGSSLPQEEKDTLTDLDTLPESRTEGNNKDETATE
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggtcatcccctcgaaggagtcagagatccaaaggctttaaggtaaagcatgct
ttacaaatctttattttgcttggggtttgcgtctggctcgtttaccaagttcagcattct
cgtggtaagaaagctactttcaatgagagcacaaaacttgatgaggttgtgaaattaggg
aggaaagatctccatccgagagttgatgaaaacatcacaagagatgagagccacagagag
gatgaagaagaaaccaggagtgagctggaaaagggtatgtctgggagtgataatgaagaa
aaggggggtgggaatgatgaatttcacgatcaacaagaagttcaggaggacactgagaat
aaagattttgtggtggatatagagaaagagagagaggagaacagtgaggttaggaaagaa
acagaaactgaagagaacaaagaaattgaaaacgaaaacaaagaaaatgaagagattaaa
gagaatgataaggaaaatggagagattcaaaagagtcagagtgatgagaatggagaggag
ggtagagggggagggattgaagagaatgtaaacgaagaaagcaaagaacacggcaatcaa
gaagtgaatggaaatgaagaaagcaaaggacaggaaaatcaagacgtgaatggaaacaat
gaaagcaaagggcaggaaaatcaagaccaaaatggaaatgaagaaagcaaaatacaggaa
aatcaagacgtcaatggaaacaatgaaagcaaagggcaggaaaatcaagaccaaaatgga
aatgaagaaagcaaaatacaggaaaatcaagacgtcaatggaaacaatgaaagcaaaggg
caggaaaatcaagaccaaaatggaaatgaagaaagcaaaatacaggaaaatcaagacgtc
aatggaaacaatgaaagcaaagggcaggaaaatcaagaccaaaatggaaatgaagaaagc
aaaatacaggaaaatcaagacgtcaatggaaacaatgaaagcaaagggcaggaaaatcaa
gaccaaaatggaaatgaagaaagcaaaatacaggaaaatcaagacgtcaatggaaacaat
gaaagcaaagggcaggaaaatcaagaccaaaatggaaatgaagaaagcaaaatacaggaa
aatcaagacgtcaatggaaacaatgaaagcaaagggcaggaaaatcaagaccaaaatgga
aatgaagaaagcaaaatacaggaaaatcaagacgtcaatggaaacaatgaaagcaaaggg
caggaaaatcaagaccaaaatggaaatgaagaaagcaaaatacaggaaaatcaagacgtg
aatggaaacgaagaaagcaaagaacacggcaatcaagaagtgaatggaaatgaagaaagc
aaaatacaggaaaatcaagacgtgaatggaaacgaagaaagcaaagaacacggcaatcaa
gaagtgaatggaaatgaagaaagcaaaatacaggaaaatcaagacgtgaatggaagcgaa
gaaagcaaaggactagaaaatcaagaggtgaatggaaacgaaggaagcaaaggactggag
aatcaagaagggaatggaaatgaagaaagtaaagaaaaggggaatcaagaagaaaatgaa
ggtaaagataaggtaaatgagatgccgactgaagacaggaaggaaaatgaaaacgaggag
agaagccagagtaatgagagtggaatgggggagaagaatgaagaaaacaaagaaaatgaa
aatcgagaggagaggattattgaagagacggataaaaaagatagcaacaatggaggagaa
agagagaaggagagtggtgacaatgagaaggaagagaccaaggagaaggacagagaagat
gttaatgtagaaaccaaagaggccatcagtgagaccaaggaaggttcccaagataccatg
gaaaacaacggtaacgagaacaaggaggagaacaacgaaaacgagacagtcaagaaggat
gaacagaaggaagttagtattaagagtgtagttccagctgaagaacaggttcaagatggg
aatgacaagagtaataacgatgcaagagaagcacaatacaaaggggataatgcttccagt
gctgtacatgaggatcaaaacacagccactggaaatgggcaggatggttttgcaaaatta
aatgaggtagagtcagttgaaaacaaagaaaactatgaatctcagcacaaggatgcacag
acgattcgcgaagatgttgattctgatagaaatgaaccagtccaaaatggaagtgaagct
gaaaaaaatggaaacaaccaatctgaggtacccgaagaagtgactaataacaatgaagag
cagccagtgtccaaggagaatgaccagcacgattcagtatcccaagagtcgaatacttct
gagcccgatcaatcagatcgacaagtgagccacaatgaaaatgaaaatgctgttcatagc
aactcgaatgatgattcttcaggtcaaaagaatgaccatgataatcctacagatatgtca
aactcccaagagaatgatgcatcatcaaacactattgaaggtgctggtgctggacggcat
gacaatgagaacgttgatcaaagcaatggaaataatagcgatcacacgaaagaaaatttt
gattcccacaatgagggtgtcagattttctgatacaaaaagcagtgaggatcagggtaat
actggtgattcttcaggatcttctttacctcaggaggagaaggatactctgacagatttg
gataccttacccgaaagcagaacagaagggaataacaaggatgaaacagccacagagtga

DBGET integrated database retrieval system