KEGG   Cucumis sativus (cucumber): 101203892Help
Entry
101203892         CDS       T02486                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 2
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
csv  Cucumis sativus (cucumber)
Brite
KEGG Orthology (KO) [BR:csv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csv01003]
    101203892
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csv02000]
    101203892
Enzymes [BR:csv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     101203892
Glycosyltransferases [BR:csv01003]
 Polysaccharide
  Structural polysaccharide
   101203892
Transporters [BR:csv02000]
 Other Transporters
  Others
   101203892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_trans_2_3 Glyco_tranf_2_3 Glycos_transf_2 Glyco_transf_21 FlaG
Motif
Other DBs
NCBI-GeneID: 101203892
NCBI-ProteinID: XP_004145779
LinkDB All DBs
Position
6
AA seq 539 aa AA seqDB search
MAETTQILLPESFQGGRGDFTEQIWLIWELIKAPLIVPVLRLMVYISLAMSLMLFFERLY
MGIVIILVKLFWKKPEKRYKYEPIQDDLELGSSNFPHVLIQIPMFNEREVYKISIGAACG
LSWPADRLVIQVLDDSTDPVIKQMVEQECLRWASKGINITYQIRETRGGYKAGALKEGLK
RSYVKHCEYVAIFDADFRPEPDYLRRAIPFLVNNPDIALVQARWRFVNADECLLTRMQEM
SLDYHFTVEQEVGSATHAFFGFNGTAGVWRIAAINEAGGWKDRTTVEDMDLAVRASLRGW
KFVYLGDLQVKSELPSTFKAFRFQQHRWSCGPANLFRKMVMEIVRNKKVRFWKKVYVIYS
FFFVRKIIAHMVTFFFYCVVLPLTILVPEVYVPIWGAVYIPSIITILNSVGTPRSIHLLF
YWILFENVMSLHRTKATLIGLLEAGRANEWVVTEKLGDALKNKAAADKKAGGKIPKVRLR
CKFGDRINTLELGFAAFLFLCGCYDFVHGKNNYFIYLFLQTFSFLITGIGYVGTIIPSS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaactacacagattctgttaccggagtcatttcaaggaggaagaggtgatttc
actgaacaaatttggttgatatgggagctaatcaaagcgccattgatagttcctgtgttg
agattaatggtttatatctcattggcaatgtctctgatgcttttctttgaaaggctttat
atgggaattgttatcattctggttaagctcttttggaagaaacctgagaaacgatataaa
tatgaacctattcaggacgatttggaattgggaagctcaaatttcccccatgttctcatt
caaatcccaatgtttaacgaaagagaggtttacaagatctccattggagctgcttgtgga
ctttcatggccggccgaccgccttgttattcaagttcttgacgattcaaccgaccctgtc
attaagcaaatggttgaacaagaatgcctaagatgggcaagtaaaggaatcaacataacg
tatcaaatcagagaaaccagaggaggatacaaagccggagctctgaaagaagggcttaaa
cgaagctatgttaaacactgtgaatatgtcgcgattttcgacgcggatttccggccggag
ccggattatctccgccgtgcgattccgttcttggtgaataatcccgatattgcccttgtt
caagctcggtggagattcgtgaatgcagatgagtgtttgttgacaagaatgcaagagatg
tctttggattaccattttacagtggaacaagaagttggttctgctactcatgccttcttt
ggcttcaatggaactgctggtgtatggagaattgctgctattaatgaggcaggtggatgg
aaagacaggaccacagtggaagacatggaccttgctgttagagctagtcttagaggctgg
aaatttgtctacttaggtgacctgcaggtaaaaagtgagcttcctagtactttcaaagcc
ttccgtttccagcagcatcgttggtcttgtggccctgccaatcttttccgcaaaatggtt
atggaaattgtcagaaacaagaaagttagattctggaagaaagtttatgtgatttatagt
ttcttctttgtgaggaagatcattgcccatatggttactttcttcttttactgcgttgtt
cttcctctcaccattttggttcctgaagtttatgtaccaatttggggagctgtttacatt
ccttcgattattaccattttgaactcagtaggaactccaaggtcaattcaccttctgttc
tactggatccttttcgaaaatgtcatgtcgttgcaccgtacgaaagcaacattgatcggt
ctattggaagccggtcgagccaacgaatgggttgtcactgaaaaacttggagatgctctc
aaaaacaaggcagctgctgataagaaagcaggtggcaaaatacctaaagtaaggttgaga
tgcaaatttggagacagaatcaacacattggagcttggatttgcagcattcttgttctta
tgtggctgctatgactttgttcatgggaagaacaattactttatttaccttttccttcag
acattcagctttctgatcactggaattggatatgttggaaccatcatcccaagctcttga

DBGET integrated database retrieval system