KEGG   Cucumis sativus (cucumber): 101208329Help
Entry
101208329         CDS       T02486                                 

Gene name
pepc1, ppc1
Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00620  Pyruvate metabolism
csv00710  Carbon fixation in photosynthetic organisms
csv01100  Metabolic pathways
csv01200  Carbon metabolism
Module
csv_M00168  CAM (Crassulacean acid metabolism), dark
csv_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
csv_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
csv_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101208329 (pepc1)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101208329 (pepc1)
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     101208329 (pepc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 E2R135
Motif
Other DBs
NCBI-GeneID: 101208329
NCBI-ProteinID: NP_001267517
UniProt: J9Y1K3
LinkDB All DBs
Position
4
AA seq 965 aa AA seqDB search
MANRNLEKMASIDAQLRLLVPARVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEGKFNPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADENSATTESDIEETLKKLVGELKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRDCLVQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCSNELRERADVLHNSSRRDAKHYIEFWKQVP
ASEPYRVILGDVRDKLYQTRERSRHLLANGYSDIPEDATFTNVEQFLEPLELCYRSLCAC
GDRAIADGTLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITQHLDIGSYKEWSEEQR
QEWLLSELSGKRPLFGPDLPTTEEISDVLNTFHVIAELPSDNFGAYIISMATAPSDVLAV
ELLQRECHVSQPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRINGKQEVMIGYSDSGK
DAGRFSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETVHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVVATE
EYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHIIQKNVKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEDLWSFGERLRANYEETKSLLLKIAGHSDLLEGDPYLKQRLRLRDSYITTLNVCQA
YTLKRIRDPNYHVKVRPHISKEIMEASKPADELIHLNPQSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctaaccggaatctggaaaagatggcatcaattgatgcgcagcttcggcttttagta
ccagccagagtgagtgaggatgataaattggtggagtacgatgcattgttactggatcgg
ttccttgacattctccaggatttgcatggagaggatctgaaggaaactgtgcaagagtgt
tatgaactttctgctgaatatgaaggaaagttcaatccaaagaaactcgaagagcttgga
aatgtgctgactagtttagatccaggggactctattgtcattgccaaatctttctcgcat
atgcttaacttggctaacttggctgaggaggttcagattgcttatcgtcgaaggatcaaa
ctgaagaagggagattttgctgatgaaaactcagcaaccaccgaatctgacattgaggaa
actctgaagaagcttgtgggggaactgaaaaagtcccctcaagaagtttttgatgcattg
aagaaccagacggttgatttggttttaactgctcatcctactcaatcagttcgtagatct
ttgcttcaaaagcatgcaagaataagggattgtttagtccagttgtatgccaaagatatc
actcctgatgacaagcaagagcttgatgaggcacttcagagagagattcaagctgcattt
cgtactgatgaaatccgtagaactcctcctaccccacaagatgaaatgagggcaggaatg
agctacttccatgagacaatttggaagggtgttcctaaatttctgcgtcgtgttgacact
gctttgaaaaacatagggattgatgaacgtgttccttataatgcaccactaattcagttt
tcatcttggatgggtggtgatcgtgatggtaatcctagggtgacacctgaggttacaagg
gatgtctgtcttcttgctagaatgatggctgctaatctttactactcacagattgaggat
ctcatgtttgagttgtctatgtggcgttgcagtaatgagcttcgtgagcgtgcagacgtg
cttcataattcatcgaggagggatgcaaaacactatatagagttttggaagcaagttcct
gccagtgaaccctaccgagtgattcttggtgatgtaagggacaagctttatcagacgcgt
gaacgttcccgccatttgttagctaatggatattctgacatcccagaggatgcgactttt
acaaatgttgagcagttcttggagcctcttgaactatgctacagatccctctgtgcatgt
ggtgaccgtgcaattgctgatggcacccttcttgattttttgaggcaagtgtccactttt
ggcttgtcacttgtaagacttgacatcaggcaagaatctgatcgtcacaccgacgtcttg
gatgccattacccagcatttggatattggttcctacaaagaatggtctgaggaacagcga
caagaatggcttttatctgaactcagtggcaaacgtcctctttttggtcctgatcttcct
acaacagaagaaatatctgatgttttgaacacattccatgtcatagctgaacttccttct
gataactttggtgcatatatcatttccatggccactgctccatctgatgttttggccgtt
gagctcttgcagcgtgagtgccacgttagtcaaccattaagagttgttcccttgtttgaa
aagcttgcagatttggaggctgcacccgcagcccttgctcgcctcttctcgatagattgg
tacagaaatcggattaatggaaagcaagaagtcatgattggctactctgattctggcaaa
gatgctgggcggttctctgcagcatggcagttgtacaaggctcaagaggagcttataaag
gttgcaaaacaatatggtgtaaaactaactatgtttcatggtcgtggtggcactgttgga
agaggaggtggacccactcatcttgctattttgtcccaaccacccgagacagttcacggt
tcactccgtgtaacagtacaaggggaagttattgagcagtcctttggagaggagcacttg
tgttttagaacactccaacgtttcactgctgcaacgcttgagcatggtatgcaccctcca
gtttcaccaaaaccagaatggcgtgcactgatggatgaaatggctgttgttgctaccgaa
gaataccgttccattgtcttcaaagaaccacgatttgtcgaatacttccgcctggcaaca
ccagaactggaatacggtaggatgaatattggaagccgtccatcaaagcggaagccaagt
ggtggtatcgagtcactccgtgcaatcccatggatttttgcatggacacagacgagattc
catctaccagtttggttaggctttggagcagcattcaagcatattattcagaagaatgtt
aagaaccttcaaatgctgcaggagatgtacaacgaatggcccttctttagggtcaccatt
gatttggttgaaatggtgttcgctaaaggagaccctggaattgctgctttgtacgacaag
ctcttagtctcagaagacctttggtcgttcggagagcgcttgagagccaactatgaagaa
acaaagagccttttgctgaagattgctggacacagtgatcttcttgaaggggatccttac
ttgaagcaaagacttcgtctccgtgattcatacatcacaactctgaacgtgtgccaagcc
tacacattgaaacgaattcgtgatccaaactaccacgtgaaagttcgaccacacatttca
aaggaaataatggaagcaagcaaaccagcagatgaactcattcatctaaacccacaaagt
gaatacgcacctgggctagaggacaccctgatcttgaccatgaagggtattgctgctgga
atgcagaacactggttaa

DBGET integrated database retrieval system