KEGG   Cucumis sativus (cucumber): 101210052Help
Entry
101210052         CDS       T02486                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101210052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csv03036]
    101210052
Enzymes [BR:csv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101210052
Chromosome and associated proteins [BR:csv03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101210052
   Polycomb group proteins
    PRC2-EZH2 complex
     101210052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 101210052
NCBI-ProteinID: XP_011649325
UniProt: A0A0A0LJN3
LinkDB All DBs
Position
2
AA seq 923 aa AA seqDB search
MASKASLPSPSADRSDLPDDTQLKPRGQDPASKEILSVIEFLKKQVAGERCNSVQKRMEE
NKQKLAGITTHLLKSSTERRIRRLSDSDKGVDLLTKRQKDALDMQNGIDVSDGENDRSQE
DGHASSAVLLGSNVAVRNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYY
GQSGGEALICSDSEEEVIDDEEEKRDFVDSEDYILRMTMKEIGSSDLVLESLASCFSRSP
GEIKARYEVLTQGEKAIGYFNNRINEEISHIGSTLLDKDLDAALDSFDNLFCRRCLVFDC
RLHGCSQDLVFPAEKQPKWGTVGEENVPCGPLCYRSVLKSDKNGIGGSPLRSDLEEKHPM
SSDGTGAQISTKKKSSCKAGRRRAKSYQSESASSNAKNISESSESENGPRQDGNTIHQSP
PPNSKITAVGGVRKRNSKRVAERVLICMQKRQKKMAASESESLASVGHCPNDVKLKSNSC
KENDDTSSSSRKNIRSPTPGRPRRRESLTQKCNKFEQNETLNNSLNEIITHLPADSCDDN
SRKEECVDENLWKQDLADDKSWKPIEKGLYEKGIEIFGRNSCLIARNLLNGMKTCWEIFQ
YMNYSENKNCSQVGDGSNPHLEGYTKGSNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIR
KRITERKDQPCRQYNPCGCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQC
RSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGR
SDISGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAY
RKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR
KPEASGSKKDDGAPSSGRAKKLA
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttctttgccttcaccttcggcagatagatcggacctgcccgatgac
acccagctgaaaccacgaggacaagatcctgcttctaaggaaatcttatcagtcattgaa
tttctaaagaagcaagttgctggggaacgttgtaactctgtacagaaaagaatggaggaa
aacaagcagaagttggctggcatcaccactcacttgttgaaatcatctacagaaagaagg
ataagaaggctaagtgattcagataagggggtggatctattgacgaagaggcagaaagat
gcacttgatatgcagaatggtatagacgtaagtgatggcgaaaatgaccgatctcaagaa
gatggccatgcatcttctgcagttcttcttggatctaatgttgcagtaagaaatgctgta
cgacctattaagcttcctgaagttaaaagattgcctccttatactacatggatatttttg
gacagaaatcagagaatgactgaagatcaatctgtagtgggtcgaaggagaatttattat
ggtcaaagtggaggcgaagccctcatttgcagtgacagcgaggaagaagtaattgatgat
gaagaggaaaagagagattttgtggattctgaagattatatacttcggatgactatgaaa
gaaattggttcatcagatctggtgctagagtcacttgccagttgtttctctagaagtccc
ggtgaaataaaggccagatatgaagtgcttacccagggagaaaaggctatagggtatttc
aataataggatcaatgaggagatctcacatattggaagtactcttcttgataaagatctt
gatgcagctcttgattcttttgacaatctattttgccgtcgttgccttgtctttgattgt
agactacatggttgttcccaagatcttgtttttcctgctgagaaacaacctaaatggggc
accgtaggtgaggaaaatgtaccctgtggtccactctgctatcgatcagtactgaaatca
gacaaaaatggtatagggggttctccacttcgcagtgacttggaagaaaaacatcccatg
tcatctgatggtactggagctcaaatctccacaaagaagaaatcttcttgtaaagctggt
cgaagaagagcaaagtcttatcaaagtgaaagtgcctcatcaaatgcaaagaacatatca
gaaagcagtgagtcagagaatggacccaggcaggatgggaatactattcatcaatcacct
ccaccaaattctaagataacagcagtgggtggagttcgaaaaagaaacagcaagcgtgtt
gctgagcgtgttctcatttgcatgcagaaacggcagaagaaaatggctgcttccgagtca
gaatctctagccagtgtaggtcattgtccaaatgacgtgaaattaaaatctaactcatgt
aaagaaaatgacgatactagttcttcttcacgtaagaatattagatctcctacacctgga
agacctaggaggagggaatccctgactcagaaatgcaacaaatttgagcagaatgaaaca
ctcaataattcattaaatgagattattactcatctaccagccgacagttgtgatgacaac
tcaaggaaagaagagtgtgtggatgaaaacttatggaagcaggacttggccgatgataaa
tcttggaagcctattgaaaaaggtctctatgagaagggtattgagatttttggtaggaac
agctgcttaatagcaaggaatttactaaatgggatgaagacctgttgggaaatttttcaa
tacatgaattactctgaaaacaagaattgcagccaagtgggtgatggatcaaatcctcat
cttgaaggttacaccaagggtagtaatgaggtgagaagaaggtcgagattcttacgtaga
aggggtagagttcgtcgactaaaatatacttggaaatcagctgcttaccattcaattcgg
aaacgaataactgaaaggaaagatcagccgtgcagacaatataatccatgtggttgccaa
actgcctgtggaaagcagtgtgcctgtcttttaaatggcacctgctgtgagaagtactgt
gggtgccccaagagttgcaagaatcgttttagaggatgccactgtgccaaaagtcaatgt
cgtagtcgtcaatgtccttgttttgcagcagatagagaatgtgatccagatgtctgtagg
aattgttgggtcagctgtggtgatggtactcttggggttcccaaccaaagaggtgataat
tatgagtgcaggaacatgaagcttcttctcaaacaacaacaaagagtgttactcggaaga
tctgatatatctggttggggagcatttctaaagaatagcgttggcaaacacgaatatctt
ggcgagtatactggggagttaatttcacatagggaggctgataagcgaggcaaaatatat
gatcgtgaaaactcgtcgtttctgttcaatttgaatgaccagtttgttcttgatgcgtat
cgaaagggcgataaactaaaatttgctaatcattctccagatccaaactgctacgccaag
gtcatcatggtggcaggagatcaccgggttggtatatttgccaaggaaagaatcagtgct
ggggaggaactcttttatgattatagatacgagcctgatcgagccccggcttgggctagg
aagcctgaggcatcaggatcaaaaaaggatgatggtgctccatcgagcggtcgagcaaag
aaactcgcataa

DBGET integrated database retrieval system