KEGG   Cucumis sativus (cucumber): 101210295Help
Entry
101210295         CDS       T02486                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00071  Fatty acid degradation
csv00592  alpha-Linolenic acid metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01212  Fatty acid metabolism
Module
csv_M00087  beta-Oxidation
csv_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101210295
   00592 alpha-Linolenic acid metabolism
    101210295
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     101210295
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     101210295
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101210295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 101210295
NCBI-ProteinID: NP_001292693
UniProt: Q39659
LinkDB All DBs
Position
6
AA seq 725 aa AA seqDB search
MGSNAKGRTVMEVGTDGVAIITIINPPVNSLSFDVLFSLRDSYEQALRRDDVKAIVVTGA
KGKFSGGFDITAFGVLQGGKGEQPNVRNISIEMITDIFEAARKPAVAAIDGLALGGGLEV
AMACHARISTPTAQLGLPELQLGIIPGFGGTQRLPRLVGLSKALEMMLTSKPIKGQEAHS
LGLVDAIVPPEELINTARRWALEILERRRPWVHSLHRTDKLESLAEARKIFNLARAQAKK
QYPNLKHTIACIDAVETGVVSGPRAGLWKEAEEFQGLLHSDTCKSLIHIFFAQRSTTKVP
GVTDLGLVPRQIKKVAIVGGGLMGSGIATALILSNYHVVLKEVNDKFLQAGIDRVRANLQ
SRVKKGNMTNEKFEKSISLLKGVLNYESFKDVDMVIEAVIENVSLKQQIFSDLEKYCPPH
CMLATNTSTIDLELIGERIKSRDRIIGAHFFSPAHIMPLLEIVRTKHTAAQVIVDLLDVG
KNIKKTPVVVGNCTGFAVNRMFFPYSQAAILLAEHGVDPYQIDRAISKFGMPMGPFRLCD
LVGFGVAAATASQFVQAFPERTYKSMLIPLMQEDKNAGESTRKGFYVYDKNRKAGPNPEL
KKYIEKARNSSGVSVDPKLTKLPEKDIVEMIFFPVVNEACRVLAEGIAVKAADLDIAGVM
GMGFPSYRGGLMFWADSLGSNYIYSRLEEWSKQYGGFFKPCGYLAERAVQGATLSAPGGH
AKPRM
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcaatgcaaaaggaagaacggtaatggaggtgggaactgatggagtagcaata
atcaccatcatcaaccctccagttaactccttgtcttttgatgtgttattcagcctgaga
gatagttatgaacaagccttgagaagagatgatgtgaaggcaattgttgttacaggtgca
aagggaaaattttctggtggctttgatataactgcttttggtgtactccaaggaggaaag
ggggagcaaccaaatgttagaaacatatcaattgaaatgatcactgatatttttgaagct
gcccgaaaacctgcggttgcagcgatagatggacttgctttgggtggagggttggaggtt
gccatggcttgtcatgctcgaatatcaactcctaccgctcaattagggttgcctgaactt
cagctcggaataattcctggttttggaggaacacaacggcttccacgtcttgttggtctc
tcaaaggccctagaaatgatgttgacgtcaaagccaattaaaggacaagaagctcattct
ttggggttagtggatgccattgtccctcccgaagagttgatcaacactgcacgtagatgg
gctcttgaaatcctagagcggagaagaccatgggttcacagtcttcacaggactgacaag
ttagagtctcttgctgaggctaggaaaatatttaacttagctagagctcaggcaaagaaa
cagtacccaaatcttaagcatacaattgcctgcattgatgctgttgaaacgggtgtcgtc
tctggccctcgtgctggactttggaaggaggctgaagaatttcagggactcctacattct
gatacttgcaaaagcttaattcatatcttctttgcccagcgttcaacaactaaggtacct
ggagttactgatctgggtttggtaccgagacaaatcaagaaagttgctattgtcggagga
ggattaatgggatctggtatagctacagcattgattcttagcaactatcatgtggtactt
aaagaagtgaacgataagttcttgcaggctggcattgacagagtcagagcaaacctacaa
agccgagtcaaaaaagggaatatgactaatgagaaattcgaaaagagtatttctttactc
aagggagttcttaactacgaaagttttaaagatgtagatatggtgatagaggctgttatt
gagaatgtttctttgaagcaacaaatcttttctgatcttgaaaaatattgccccccacat
tgcatgcttgctactaatacttccacaatagacttggagttgattggagagagaataaag
tctcgtgacaggattattggagctcatttctttagtcctgctcacatcatgccgctattg
gaaattgtccgtaccaagcatacagctgcacaagtgattgttgatctgctagatgttggg
aagaatataaagaaaacaccagttgtcgttggaaattgtacaggttttgctgtcaacaga
atgttttttccctactctcaggctgcaattttacttgcagaacatggggtagatccctat
cagattgacagggctatttccaagtttggaatgccaatgggacccttcaggttgtgcgac
cttgttggttttggtgtggcagcagcaactgccagtcagtttgttcaagcttttccagaa
agaacttataaatcgatgctaattcctctgatgcaagaggataagaatgcaggtgaatcc
actcgtaaaggtttctatgtctatgacaagaaccgaaaagctgggccaaatccagagtta
aagaaatatatcgagaaggctaggaacagttctggtgtttcagttgatcctaagctcaca
aagttacccgaaaaggacattgtggagatgatatttttcccagtggtgaatgaagcatgt
cgtgtccttgccgaaggcatagcagtcaaagcagctgacctggacattgctggtgtaatg
ggaatgggtttcccctcctacaggggaggactcatgttctgggcggattctcttggatca
aattacatctattcaaggttggaggaatggtcgaaacagtatggtggatttttcaagccc
tgtggatacttagctgaaagggctgttcagggtgcaactctgagtgctccgggtggccat
gctaaacctcgaatgtaa

DBGET integrated database retrieval system