KEGG   Cucumis sativus (cucumber): 101210759Help
Entry
101210759         CDS       T02486                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00564  Glycerophospholipid metabolism
csv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101210759
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     101210759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox FAD_binding_3 Pyr_redox_3 GIDA Lycopene_cycl NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-GeneID: 101210759
NCBI-ProteinID: XP_004140212
UniProt: A0A0A0KHI3
LinkDB All DBs
Position
6
AA seq 629 aa AA seqDB search
MATATRLSKLAVAAVATAVGGSILLQPSLSSNDRGTSGHALDSYRNKINDPTAVVPPRSV
QESALIGASPVNPLDILVVGGGATGCGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYKQLKLVFHALEERKQFIENAPHLCHALPCMTPCFDWFEVIYYWIG
LKMYDLVAGRRLLHLSRYYSAQESVELFPTLARNGGGRSLKGTVVYYDGQMNDSRVNVGL
ACTAALAGAAVLNHAEVVGFLKDDASDRIIGARIRDKLSGREFDTYAKVIVNAAGPFCDS
VRKMADKEAVSMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTGITMLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLAIDPSAQNTESISR
DHVVCEDYPGLVTITGGKWTTYRSMAEDAVSAAIKSGKLKPTNECVTDKLQLAGGDGWEP
AYFTVLAQQYLRMKKTHNGKVVPGVMDTAAARHLSQAYGVLAERVAAIAQNESLGKRLAH
GYPFLEAEVAYCARHEYCESAVDFIARRSRLAFLDTDAANHALPRVIELLAAEHKWDRSR
QKQELEKAKKFLETFKSSKNAQFHDGKHN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctacacggctgagcaagctcgccgttgccgccgtagccaccgcagtcggt
ggctctatcctacttcaaccttctctctcctccaatgaccgtggcaccagtggtcacgcg
cttgattcctacagaaacaagatcaatgatccgactgcagtcgttccaccgcgatcagtc
caggagtctgctttgatcggagccagtcccgtcaatccgcttgacattcttgtcgtcggc
ggaggcgctaccggttgtggagtcgctcttgatgccgtcactcgaggacttcgcgttggt
ctcgtcgagcgcgaggatttctcgtccggcacgtcttcgcgctctacgaagctcattcat
ggaggcgtgcggtatttggagaaagcagtgttcaatttggattataagcagcttaaactg
gtgtttcatgcgcttgaggaacgaaaacagtttattgaaaatgcaccgcacttatgccat
gcgttgccctgcatgacaccttgttttgactggttcgaggtcatctactattggattggg
ttgaagatgtacgatcttgttgcagggcgtcgtctcttgcacttatctcggtactattct
gctcaggagtctgtggagctcttccctacccttgctaggaatggtgggggcaggagtttg
aaaggcactgtggtgtattacgatgggcagatgaatgactcgcgggtcaatgtagggctg
gcttgtactgccgctctcgctggcgcggcggtgcttaaccatgctgaagttgtgggattt
ttgaaggatgatgctagtgatcgaattattggtgctagaattcgtgacaagttgtcaggt
agagagtttgatacctatgcaaaggtgattgtcaatgctgctgggccattttgtgactca
gttagaaagatggctgataaagaggcagtgtctatgatctgtcccagcagtggtgtccat
atagttctacctgattattattctcctgaaggaatgggtctaattgttcccaagactaag
gacgggcgtgttgtgtttatgcttccatggttaggacgaacagttgctggaaccacagat
tccaacacgggcatcaccatgcttcctgagccacatgaggatgaaattcagtttatactg
gatgcaatctctgattaccttaacgtgaaggtgaggcgaacagatgttctctcagcatgg
agtggtattcgtcctttggctattgacccatcagctcaaaatacagaaagcatctcaaga
gatcatgttgtatgtgaagattatcccggattggtcacaattaccggtgggaaatggact
acttatcggagcatggcggaggatgctgttagtgcagctatcaagtctggaaagctgaaa
ccgacaaatgaatgtgtaactgacaagctgcagcttgctggtggagatggatgggaacct
gcatatttcactgtcttagctcaacaatatttgcgcatgaagaagactcataatggtaaa
gttgtccctggggttatggacactgcagctgctagacatttatctcaagcgtatggtgtt
ttagctgagagagtggccgccatagcccagaatgagagtttggggaagcggttagcccat
ggctaccccttcttagaggctgaagttgcatactgtgcacgacacgagtactgtgaatct
gcagtggatttcattgccagaagatcaagacttgctttcctcgatacggatgctgctaac
catgcgttgccacgagtaattgagctgttggcagctgaacataaatgggataggtcaaga
cagaagcaagaactagagaaggccaagaaatttctagaaactttcaagtcttcaaagaat
gctcaattccatgatggaaaacacaactag

DBGET integrated database retrieval system