KEGG   Cucumis sativus (cucumber): 101210903Help
Entry
101210903         CDS       T02486                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00250  Alanine, aspartate and glutamate metabolism
csv00410  beta-Alanine metabolism
csv00430  Taurine and hypotaurine metabolism
csv00650  Butanoate metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Module
csv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101210903
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101210903
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101210903
   00430 Taurine and hypotaurine metabolism
    101210903
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101210903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 101210903
NCBI-ProteinID: XP_011649550
UniProt: A0A0A0LSI3
LinkDB All DBs
Position
1
AA seq 496 aa AA seqDB search
MVLTTVADSGDSVNCTFGSRYLRSPPPKFKLGEQSIPKDAAYQIIHDELMLDGTPRLNLA
SFVTTWMEPECDNLIMASINKNYVDMDEYPVTTELQNRCVNMIARLFHAPIGDQEAVVGV
GTVGSSEAIMLAGLAFKRKWQQRRKSQGKPCDKPNIVTGANVQVCWEKFARYFEVELKEV
KLSEGFYVMDPVKAVELVDENTICVAAILGSTLTGEFEDVKLLNELLSKKNEETGWDTPI
HVDAASGGFIAPFLYPDLDWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSNQDLPEELV
FHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNVMENCRENARVLREGIEKM
GRFEVVSKDVGVPLVAFTLKDSSKHTVFEISENLRRFGWIVPAYTMPADAQHIAVLRVVI
REDFSRSLAERLISDIDKVLKEVEALPIRVSLAEVKAGVEDGGRVRKHVKKSEREIGEEI
TTYWRRLVDGKRTGAC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttttgacgacagtggcagactctggagattctgtgaactgcacttttggttccaga
tatctccgctcacctcctcccaagttcaaattgggggagcaatctattccaaaggatgca
gcgtatcagatcatacacgatgaattgatgcttgatggaactcccaggctgaacttggct
tcttttgttactacttggatggaaccagagtgtgacaatctcatcatggcttctatcaac
aagaactatgttgacatggatgagtaccctgtcactaccgagctacagaatcgctgtgtc
aatatgattgctcgcctctttcatgctcccatcggagatcaagaagctgtagttggtgtg
gggactgtgggatcatcagaggctataatgctggcgggtcttgcttttaaaaggaaatgg
caacaaagaagaaaatctcaaggaaaaccctgtgataaacccaatatagtcactggtgct
aatgtccaggtgtgctgggagaagtttgcaaggtactttgaggttgagctaaaggaggtg
aagctttctgaagggttttatgtgatggatccagtgaaggctgttgaacttgttgatgag
aatactatttgtgttgcggcaattttgggatccactctgactggggagtttgaggatgta
aaactccttaatgaacttctttctaagaagaatgaggaaactggttgggataccccaatt
catgttgatgcagccagtggagggtttattgctccattcctttatcctgatctcgactgg
gattttagattgcctttagtgaagagtataaatgtcagtggtcacaagtatgggcttgtg
taccctggtgtaggatgggttgtttggaggagtaatcaggatttgcctgaggagcttgtt
ttccacattaactatcttggttctgatcaacccaccttcactcttaatttctcaaaaggt
tctagccagatcattgctcaatattatcagtttatacggcttggatttgaggggtacaaa
aacgtgatggagaactgcagggagaatgcaagagtgctgagagagggaatagagaaaatg
ggaaggtttgaggttgtttccaaggatgttggagtgcccctggtagccttcactctcaaa
gacagcagcaagcacactgtgttcgagatatcggagaacctgaggaggtttggatggatt
gtgccagcttacacgatgccagcggatgctcagcatattgcagtgctgcgagtggtgatt
agagaggacttcagccgcagtttggcagagagactgatctcggacattgacaaagtcttg
aaggaagtcgaggccctgccaattcgggtgtctttggcagaagtgaaagctggagttgaa
gatggtggcagagttagaaagcatgtgaagaagagtgaacgggagattggggaggaaata
actacatattggagacggcttgtggatgggaagagaactggcgcttgctag

DBGET integrated database retrieval system