KEGG   Cucumis sativus (cucumber): 101211616Help
Entry
101211616         CDS       T02486                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00020  Citrate cycle (TCA cycle)
csv00190  Oxidative phosphorylation
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101211616
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101211616
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101211616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 101211616
NCBI-ProteinID: XP_011653136
UniProt: A0A0A0KUM6
LinkDB All DBs
Position
4
AA seq 635 aa AA seqDB search
MWRCVSRGLRASSSFSRKSSPNDHLRSQFSRFFSADSTAGRSSYTVVDHTYDAVVVGAGG
AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCAC
AADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGSCQGVIALNMEDGTLHRFRAA
STILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEG
SRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNH
LPPDVLKERLPGISETAAIFADVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPD
AIIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIGRPGAQQKPLEKDAG
EKTIAWLDKLRNSNGSLATSKIRLNMQRVMQNNAAVFRTQETLEEGCKLIDKAWESFRDV
RVKDRNLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHT
LGFWENEKVRLDYRPVHMNTLDDEIETFPPKARVY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtttctcgtggtcttcgtgcttcttcttccttttccaggaaatcgtcc
cccaatgatcacctcagatctcaattttctagattcttctccgccgattcgacggctggt
cgctcctcatacactgtggttgatcacacatacgatgcagtcgtggtaggtgcgggtggt
gcagggcttcgagctgctatcgggttgtcagagcatggatttaatactgcttgcattact
aagctttttccaacccgttctcacacggttgcagcgcagggaggtataaatgctgcactg
ggaaacatgactgaggatgattggaggtggcacatgtacgacactgtcaaggggagtgat
tggctaggtgatcaggatgccattcaatacatgtgtagagaagcaccgaaagcagttatt
gagcttgagaattatgggcttcctttttctcgtactgaagatggaaaaatatatcaacgt
gcatttggtggccagagtcttgactttggaaagggtggacaggcatatcgctgtgcgtgt
gctgctgaccgaacggggcatgctttattacatactctctatggccaggctatgaagcat
aacacacagttttttgtggaatatttcgctttggatctaataatgaatagtgatggtagc
tgccagggagtgatagcactaaatatggaggatggtacgctacatcggtttcgagctgca
tcaacaattttggctactgggggttatggcagagcatatttctcagcaacctctgctcat
acttgcactggagatggaaacgccatggttgcacgagctgggcttccacttgaggatttg
gagtttgtgcagtttcatccaacaggaatttatggtgctgggtgccttattactgaagga
tctcgtggtgaaggtggcattcttaggaacagtgaaggtgagcgctttatggaacgatat
gccccgacagcaaaggatcttgcatcaagagatgttgtgtctagatccatgactatggaa
attcgggagggtcgtggtgttggacctttgaaggaccacatatatcttcatttaaatcac
ttaccaccagatgtactgaaggagaggcttccgggtatctcagaaactgctgccattttt
gctgacgttgatgtcaccaaagaacccatcccagttttaccaacagtgcattataatatg
ggtggaattcccacgaatcatcatggagaggtagttacaatcaagggaaacgatccagat
gccattattccaggattgatggctgctggggaggcagcttgtgcctcggttcatggtgcc
aataggcttggtgcaaattcgcttttggacattgttgtcttcggacgagcttgtgcaaac
agggttgcagagattggtagaccaggggcacagcaaaagccattggaaaaagatgctggt
gagaagaccattgcatggctagacaagttaagaaactcaaatggttcacttgccacctca
aagattcggttgaacatgcaaagagttatgcaaaacaatgctgctgttttccgaacgcag
gagaccttggaagaaggttgcaaactaattgacaaggcctgggagagtttccgtgatgtt
cgggtcaaagacaggaatttaatatggaacactgatttgatagagacaattgaattggaa
aatcttttgataaatgcatgtattactatgcactctgctgaagccaggaaagagagcaga
ggagcacatgcccgtgaagatttcacgaaaagagacgatgagaactggatgaagcacaca
ctaggattctgggaaaatgagaaggtcagactggactataggcctgtgcatatgaacaca
ttggacgacgagatcgaaacattccctcccaaggctcgtgtatactga

DBGET integrated database retrieval system