KEGG   Cucumis sativus (cucumber): 101213447Help
Entry
101213447         CDS       T02486                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv03030  DNA replication
csv03410  Base excision repair
csv03420  Nucleotide excision repair
csv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:csv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101213447
   03410 Base excision repair
    101213447
   03420 Nucleotide excision repair
    101213447
   03430 Mismatch repair
    101213447
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csv03032]
    101213447
   03400 DNA repair and recombination proteins [BR:csv03400]
    101213447
Enzymes [BR:csv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101213447
    6.5.1.6  DNA ligase (ATP or NAD+)
     101213447
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101213447
DNA replication proteins [BR:csv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101213447
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101213447
DNA repair and recombination proteins [BR:csv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101213447
   NER (nucleotide excision repair)
    Other NER factors
     101213447
   MMR (mismatch excision repair)
    Other MMR factors
     101213447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF5562
Motif
Other DBs
NCBI-GeneID: 101213447
NCBI-ProteinID: XP_004145818
UniProt: A0A0A0KGJ2
LinkDB All DBs
Position
6
AA seq 801 aa AA seqDB search
MLSLRSCFYLRPITLPHPQFKKLIFSNNSSFSFKPISHNFVSPMSSRPSAFDALMSGARA
AAKKKPANSSPKKRKALDSLDSPLKPSSFLALESTPPVESQCGSSVSNLDDHGGTHLDGV
DLGETKLRQDNDGGVGAKIGPFGNKTCASSVQERTAKLKSSTAELKKKAKDFNSKNVACW
KEGERVPFLFLCLGFDMISEESSRITITDIVCNMLRTVMDTTPDDLVATVYLLANKIAPA
HEGLELGIGDASIIKALSEAFGRTEAQVKKQYKELGDLGLVAKASRSSQSMMRKPDALTV
TKVFDTFRLIAKESGKDSQEKKKNHIKSLLVAATDCEPLYLIRLLQTKLRIGLAEQTLLA
ALGQAAVYSEKHSTPPPNIQSPLEEASKIVKQVYSILPVYDKLVPALLSGGVWNLSKTCN
FTPGIPIGPMLAKPTKGVSEILNKFQGLEFTCEYKYDGERAQIHYMEDGSVEIYSRNAER
NTGKFPDVVLTVSRIKKPSVRSFILDCELVAYDRGKQKILPFQILSTRARKNVAVSDIKV
EVCVFAFDLLYLDGQPLIQRELNVRRELLYNSFIEESGYFQFATAIITNDLEEIQKFLDA
SVDQSCEGLIIKTLNRDATYEPSKRSHNWLKLKKDYIDSIGDSLDLVPIAAFHGRGKRTG
VYGAFLLACYDNDNEEFQSICKIGTGFSEAMLEERSASLRSKVIPEPKSYYRYGDTINPD
VWFEPTEVWEVKAADLTISPVHRAGVGIVDSDKGISLRFPRLVRVREDKNPEEASSSEQV
ADMYNAQKHNHQNNQDDNGDD
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgctttctctgcgttcatgtttctatctacgtcccatcacattgcctcatccccaattc
aagaaactcattttctccaacaattcttccttctctttcaaacccatatctcataatttt
gtttcaccaatgtcttctcgtccttccgccttcgatgctctcatgtctggtgctcgtgcc
gctgccaagaagaagcctgctaattcttctcccaagaagcgtaaagcccttgattcttta
gattctcctctgaaacctagctctttccttgctcttgagtcaacgccgcctgttgaatcg
cagtgcggcagttcagtttcaaatttggacgatcatggaggtactcatttggatggtgtc
gatttgggagaaaccaaattgcgtcaggataatgatggcggtgttggagccaagattggg
ccatttgggaacaagacttgtgcgtctagtgttcaagaaagaacagcgaaattgaagagc
tctactgcagagttgaaaaagaaggctaaggatttcaactcgaagaatgtcgcatgttgg
aaagagggtgaacgtgttccctttttgtttctgtgtttggggttcgatatgatttcggag
gagtccagtaggattactatcactgatatagtctgcaacatgctgaggaccgtcatggat
actacacccgacgacttggtagccactgtttatcttttggcgaataagattgctccagct
catgaagggcttgagttggggattggggatgcttctattatcaaagctctttctgaggca
tttgggaggacagaggcacaggtcaaaaagcagtacaaggaattgggagatttgggtctt
gttgctaaagctagccgttcatctcaatctatgatgcgaaagcccgatgctttaactgtt
accaaagtatttgacacatttcgactgattgctaaggaatctggcaaggatagtcaggag
aagaaaaagaatcatatcaagtcactgcttgttgctgccactgactgtgaacctttatat
ctgattagattgctgcagacaaaattgcgaattggacttgctgagcagactcttttagct
gcattaggacaagcagctgtatattctgaaaagcactcaacaccacctccgaatattcaa
tcccctctagaagaggcttctaagattgtaaagcaggtgtattctatacttccagtttat
gacaaacttgttcctgcccttcttagtggtggtgtgtggaatctttcaaaaacatgcaac
tttacaccgggaattccaattggacccatgctggcaaaaccaacaaaaggagtgtctgag
atcttaaataaattccagggtttggaatttacttgtgaatacaaatatgatggggagcgt
gcccagatacattacatggaagatggttcagttgagatatatagtcgaaatgctgaacga
aacacaggaaagttccctgatgttgttctcacagtatcaaggataaagaaaccatctgta
agatcatttattttggattgtgaacttgttgcttatgatcgtggaaaacaaaagattcta
ccctttcagattctgagtactcgagctcgtaagaatgtggctgtgagtgatattaaggtt
gaagtgtgtgtatttgcttttgatttactctatcttgatggtcaaccacttatccaaaga
gaacttaatgttcgtcgagagcttctctacaattcatttattgaagaatctggatatttt
caatttgccacagcaataataacaaatgatcttgaggaaatacaaaagttccttgatgca
tcggttgatcaaagctgtgagggtttaatcatcaaaacactgaaccgggatgccacttat
gagccttccaagaggtctcataactggctaaaactgaagaaggattacatagacagcata
ggggattcacttgatctggtaccgattgctgccttccatggccgtgggaaacgtacaggt
gtctatggtgcatttctccttgcctgttatgataatgacaatgaagaatttcaaagtatt
tgtaagataggaactgggttttctgaagcaatgcttgaggaacgttctgctagtctccgt
tctaaagtcatccctgaaccaaagtcatattatcggtatggagatacaatcaatccagat
gtttggtttgagccaactgaggtttgggaggttaaagctgcagacttgactattagccca
gttcatcgtgcaggagtcggcattgtggactctgacaagggaatttctctccgatttcca
cgtcttgttcgtgtgagggaagacaaaaatccagaggaagcctcatcatcagagcaggtt
gccgacatgtataatgctcagaaacacaaccaccagaacaatcaagatgacaatggagac
gactaa

DBGET integrated database retrieval system