KEGG   Cucumis sativus (cucumber): 101215417Help
Entry
101215417         CDS       T02486                                 

Gene name
SOD
Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:csv00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101215417 (SOD)
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101215417 (SOD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101215417
NCBI-ProteinID: NP_001267697
UniProt: B1PE19
LinkDB All DBs
Position
1
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPAGKQHGAPEDENRHAGDLGNIIVGEDGKANFTITDCQIPLCGHESIIGRAVVVHG
DPDDLGKGGHELSSSTGNAGARVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggctgttcttggaagtagtgagggtgttagtggaactatctttttc
acccaagaaggagacggtccaaccactgttacgggtaatgtttctggtctcaagcccggg
cttcatggattccatgttcacgccttaggtgacacaaccaatggctgcatgtcgactggg
ccacatttcaaccctgctggaaaacaacatggtgctcccgaggacgagaaccgccatgcc
ggtgatttagggaacattatcgttggtgaagatggcaaggctaacttcaccattactgac
tgccagattcctctctgtggacatgaatccattatcggaagggctgttgtggttcatgga
gaccctgatgatcttggcaagggtggacatgaactcagctcaagtacaggaaatgctggt
gctagagtagcctgtggcattattggtctgcaaggttaa

DBGET integrated database retrieval system