KEGG   Cucumis sativus (cucumber): 101216298Help
Entry
101216298         CDS       T02486                                 

Definition
(RefSeq) uncharacterized LOC101216298
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv03030  DNA replication
csv03410  Base excision repair
csv03420  Nucleotide excision repair
csv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:csv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101216298
   03410 Base excision repair
    101216298
   03420 Nucleotide excision repair
    101216298
   03430 Mismatch repair
    101216298
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csv03032]
    101216298
   03400 DNA repair and recombination proteins [BR:csv03400]
    101216298
Enzymes [BR:csv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101216298
    6.5.1.6  DNA ligase (ATP or NAD+)
     101216298
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101216298
DNA replication proteins [BR:csv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101216298
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101216298
DNA repair and recombination proteins [BR:csv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101216298
   NER (nucleotide excision repair)
    Other NER factors
     101216298
   MMR (mismatch excision repair)
    Other MMR factors
     101216298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL DNA_ligase_A_N UBA_4 RMMBL Lactamase_B_2 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 101216298
NCBI-ProteinID: XP_011653418
LinkDB All DBs
Position
4
AA seq 882 aa AA seqDB search
MASESSTPKPLAIDSSLCFVTAIESFSRQLSLSLPPLKLPFRPPPFPSDFPQSKLIPKSR
FVVDAFAHAGDYSLSYFLSHFHSDHYGGLSPTWCKGIIFCSHLTARLLLEVLKVPLPFVY
PLPLREPTTIDGCEVILVDANHCPGAVQFLFKIPCGDGKFERYVHTGDFRFFDSMRVDPV
LEMFIGSDAVFLDTTYCHPKFIFPSQEESIEYIVNIIQKIGGASKGSMGNVLFLVATYVI
GKEKILLQIASRCNRKIMVDAKKMTVLRVLGYGESGVFTEHESESDVHVVGWNVLGQTWP
FFRPNFVRMKDIMVEKGYSKVVGFVPTGWTYEFKHNKFSVRSKDSLEIHLVPYSEHSNYN
ELSEYVKFLRPKRVVPTVGLDVDKLDSKHADKIKKHFAGLVDEMANRKEFLKGFQRGSGE
MSDDVDENATKAETEFLEFKEKEISSCMKISVKTEASSSGMGLSSLQEVGSTDLFESNDG
EQQKIIQELRECLPAWVTQDQILDLISSSGRNVVDAVSNFYERETEFYEHISTLTDICPK
YPSKVSDSPFIFPATDNKKVVVLGEIDISSGHASKSSSPRGTAKTKTSPAKRKRNIQDKP
KNKSRKNLILQSDGSKQSTITKFFRKTPHFSDCPKMESIEEQNCQDQSSPNGITEYVNKI
DKFIQIINGDESLKTLVASLLVKTNGDMNMALDLYYTNHQERLGQNEKGHIFSANPIQTE
SNSDECLSTQKKNMLENIGLETDLSKKINETFVSLPPEDYDPVKHACWRYGQPAPYIHLV
RTFDLLEEEKGKIKATSMLCNMFRSLLVLSSEDVLPAVYLCTNKIAADHENMVLLLNFIL
YKLCFNNIKFTLCFWMSVLLPDESYARKLLPFIINCFSPHSF
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgaatcttccacacctaaacccctagcaatcgactcttccctctgcttcgtc
actgctatcgaatcgttttcgcggcaactgagtttatctcttcctccgttgaaacttcca
ttccgaccccctccttttccctccgatttcccccaatccaaactcatcccaaaatcccgt
ttcgtggtcgacgcatttgcccacgccggcgattactctctttcatatttcctttctcat
tttcattccgatcactatggtggtctctcccctacctggtgcaagggtattatcttctgc
tcccaccttactgctcgccttttgctcgaagttctcaaagtccctctgccattcgtctac
ccattgccgcttcgggagcctacaacaatagatggctgtgaggtaatactagttgatgcc
aatcattgtcctggtgcagtccagttcttgtttaagattccttgtggggatgggaagttt
gagagatatgttcatactggggattttcggttttttgattctatgagagtcgaccctgtt
ttggaaatgtttattggctcggatgcggttttcttggatactacgtactgtcatccgaag
tttatttttccttcccaggaggagtctattgaatatatagttaacatcatacaaaaaatt
ggaggtgcaagtaagggttctatggggaacgttctttttctagtcgcaacttatgtgatt
ggaaaggaaaaaattttgcttcaaattgcgagtcgatgtaatcgtaagataatggtggat
gctaagaaaatgacagtcttacgtgttttgggatatggtgagagcggggtgtttaccgag
catgaaagtgaaagtgatgttcatgttgttggatggaatgtgttgggtcaaacgtggcct
ttttttaggcctaattttgttagaatgaaggatataatggtggaaaagggttattcgaaa
gtcgttggttttgttccaacagggtggacttatgagtttaaacacaacaagttctccgta
aggtccaaggattcactagagatacatctggtgccatatagtgaacactcaaactacaat
gaacttagtgaatatgtgaagtttttgagacctaaaagagttgttcccactgtgggtttg
gatgttgataaacttgatagcaagcatgctgataaaattaaaaagcactttgctggttta
gttgatgaaatggccaacagaaaagaattcttaaaagggtttcaacgtggatctggtgaa
atgagtgatgatgttgatgaaaatgccacaaaggctgaaactgagttcctggagttcaaa
gaaaaggaaatttcatcgtgtatgaagataagtgtcaaaaccgaagcatccagtagtggt
atgggtttgtcttctctgcaagaagttggttctaccgatctatttgagtcaaatgatggg
gaacaacagaagattatccaggaacttcgtgagtgcttgcctgcatgggtcactcaggat
cagatattagatctgattagcagctctgggagaaatgttgttgatgcagtttctaatttt
tatgaacgagaaactgaattttatgaacacatttcaactctaacggatatctgtcccaag
tacccaagtaaagtatcagatagcccgtttatttttcctgcaacagataataaaaaggtg
gtcgttttgggagaaattgacatttcttcaggccatgcttcaaagtcatccagtccaagg
gggacggccaaaactaaaacttctcctgctaaaaggaagagaaacattcaagataagccc
aaaaataagtcgagaaagaatttaattctgcaatctgatgggtctaagcaatctacaatc
acaaagttcttcaggaaaactccacatttttcagattgtcctaaaatggaatctatagaa
gagcaaaattgtcaagatcaaagttctccaaacggtattaccgaatatgtaaacaagatt
gacaagtttattcaaataataaatggtgacgaatcattaaaaacacttgttgcatcatta
ttggtaaagacaaacggagacatgaatatggcacttgatttgtattatactaatcatcag
gagagacttggtcaaaatgaaaagggtcacatcttcagcgcgaacccaatccaaactgaa
agcaattcggatgaatgcttatctactcagaagaaaaacatgctagaaaatattggactt
gagactgatttgtctaagaagataaatgaaacttttgtatcccttccacctgaagattat
gatccagtcaagcatgcctgttggcggtatggacagcctgccccatatatacatcttgta
cgtacttttgatctgcttgaagaggaaaaagggaagataaaagctacatctatgctttgc
aatatgtttagaagtttattggttttgtcttctgaggatgtgctgcctgcagtgtattta
tgcactaacaaaattgctgctgaccatgaaaacatggttttgttacttaactttattctc
tataaattatgtttcaataatataaaatttaccttgtgtttttggatgagtgttctttta
cctgatgaaagttatgcacggaagttgttaccttttatcattaattgtttttctccccat
tcattttaa

DBGET integrated database retrieval system