KEGG   Cucumis sativus (cucumber): 101216685Help
Entry
101216685         CDS       T02486                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00052  Galactose metabolism
csv00500  Starch and sucrose metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101216685
   00500 Starch and sucrose metabolism
    101216685
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101216685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101216685
NCBI-ProteinID: XP_011660330
UniProt: A0A0A0M3Y3
LinkDB All DBs
Position
1
AA seq 920 aa AA seqDB search
MDLTHTHFPLPQKTMASGSSKVIRTPFPHSLPILILFLFTSFLPLPAASLPAVGLGYRIR
SSHVDPAGKTLTADLDLIGTSQVYGPDLPTLTLQATFESKDRLRVRITDSTRERWEVPHH
ILPRPSSSLIRSLPENHVASPKASFISHPASDLIFTLHDTAPFGFSVLRRSSGDVLFDTS
PAFSDSETFLVFKDQYIQLSSSLPKDRSSIFGIGEQTRKSFKLVPDKNKTLTLWNADIGS
VNLDVNLYGAHPFYIDLRSPSQDGKVAAGTTHGVLLLNSNGMDIMYSGDRITYKVIGGII
DLYFFAGPSPISVVDQYTELIGRPAPVPYWSFGFHQCRYGYKNVSDIESVVARYAKASIP
LEAMWTDIDYMDGYKDFTFDPINFPSQKMKIFVDNLHKNGQKYVLILDPGISTNNTYGPY
IRGTKADIFMKYNGVPYLGDVWPGPVYFPDFFHPDSETFWGREIQIFRDIVPFDGLWIDM
NEISNFITSSTSPLSNLDNPPYMINNARVQRPLNNKTVPASILHFGNLTEYNTHNLYGFL
ESRATHASLVKVTGQRPFVLSRSTFVGSGKYTAHWTGDNGATWNDLGYTIPSILNFGLFG
IPMVGSDICGFSGDTTEELCRRWIQLGAFYPFARDHSDKGSIRQELYLWDSVAASARKVL
ALRYQLLPYFYTLMYEAHKKGTPIARPLFFSFPQDIKTHEIDSQFLLGGGVLVSPVLKEG
AFSVDAYFPAGNWFSLFNYSEFVAVNSGQQINLDAPADHINVHVREGNILALHGEAMTTR
AAQETPYKLLVVISNGQSSFGEVFLDDGEVVEMGREGGNWSMVRFYSETVGSKLVVKSQV
INGGFALSQKLIIDKVTFVGFKRPKKMVDLGLNISKGLNLNGNSSIRKTYQYFAKFMNVE
ISGLSIPIWEEFILEMTPIN
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggacctcactcacacacacttcccactgccacaaaaaacaatggcgagtggttcgtcc
aaagtcataagaacgccatttcctcactctctcccaatactaatactctttcttttcact
tccttcctccctctgcccgctgcttctctaccagccgtcggacttgggtaccgaatcaga
tccagccacgtcgatcctgccggaaagacattgaccgccgatcttgacctcatcggtacc
tcccaagtctatggacctgatcttcccacacttaccctccaagccacttttgaaagcaaa
gaccggttgagagtacgaataacggactcaactcgtgaacggtgggaggttccacaccat
attcttccccgtccatcgagctcccttatccgttcactgccggaaaaccatgtcgcctcc
ccgaaagcttctttcatctcccatccagcttccgatctcattttcaccctccatgacact
gcacccttcggattttccgtgctccgacgatcatccggtgatgtcctctttgacacatcc
cctgctttctccgattccgagacttttcttgtcttcaaggatcaatacattcaactatcc
tcttcgcttcccaaggacagatcctctatctttggcattggcgagcaaacccggaagtcg
ttcaagctcgtcccggataaaaacaaaactctaactctttggaacgccgatattggtagt
gtgaatctcgatgtgaacctctatggtgcacatcctttctacattgatctccggtcgccg
tctcaagatggtaaagttgcggcagggacgacgcatggagttttgttgctcaatagtaat
ggcatggatattatgtactctggcgataggattacatacaaggttattggtggaatcatt
gatttatacttctttgcgggtccgtcaccaatttcggttgtagatcagtatactgagctt
attgggcggcctgcacctgtgccttattggtcgtttggttttcatcaatgtcgttacggc
tacaagaatgtttctgacattgaaagtgtagttgctcgttatgccaaagccagtatacct
cttgaagctatgtggacagacattgattacatggatgggtataaagactttacttttgat
cccatcaattttccatcgcagaagatgaagatatttgttgataatcttcacaaaaatgga
caaaaatatgtactcatcttggatcctggtattagtacaaataatacatatggaccatac
attcgaggaacaaaagctgatatctttatgaaatacaacggggttccatacttgggtgat
gtttggcctggacctgtttactttcctgatttttttcatccagacagtgagactttttgg
ggtcgtgagatccaaatttttcgagatattgttccatttgacggtctttggatcgatatg
aatgagatatcaaattttataacttcttcaaccagcccactttctaaccttgataaccct
ccttacatgattaacaatgctagagttcaacgtccccttaataataagactgtgccagcg
tcaattcttcattttggtaacttgacagagtataatactcataacctatacgggttctta
gagtcaagggctactcatgcctcattagtaaaagtaacaggccagagaccatttgtgctg
tcaagatcaacttttgtaggctctgggaagtacacagcacattggaccggagataatggt
gcgacgtggaatgatttgggatacacgattccatccattttgaactttggactcttcgga
attcctatggttggttctgacatatgtggattttccggagatacgacagaagagctttgc
cgacgttggattcagttaggtgcattttacccatttgccagagatcattctgataaagga
tccattcgtcaagagctttatctttgggattcagttgctgcatcagccaggaaggtgctt
gcgcttcgctatcagctacttccttatttctacactttgatgtatgaggcacacaaaaag
gggacaccgatcgctcgtcctctcttcttctcattccctcaggatatcaagacccacgaa
atcgactctcagttcctacttggaggaggtgtattggtttctccagttctaaaggaggga
gctttttctgttgatgcatatttccccgcaggaaactggtttagcctctttaactattca
gaattcgtagctgtaaattccgggcaacaaatcaatcttgatgcacctgctgatcacata
aacgtgcacgtcagggaaggaaacattctggcattacacggagaggcgatgacaacgcga
gcagcccaagagaccccatacaagcttttggtcgtcatcagcaatggtcaaagcagcttt
ggagaggttttcttggatgatggagaagtggtggaaatgggaagagaaggaggtaattgg
agtatggtaagattttatagtgaaacagttgggagtaagttagtagtgaaatctcaggtt
ataaatgggggatttgccttgagccaaaaactgattattgacaaggtgacctttgtaggc
ttcaaaaggcctaagaaaatggttgacctgggtttaaatataagcaagggattgaacttg
aatggcaattcaagcattagaaaaacctatcaatattttgccaagtttatgaatgttgag
atctcagggctatccattcctatttgggaggaattcatattggagatgacaccaataaat
tga

DBGET integrated database retrieval system