KEGG   Cucumis sativus (cucumber): 101217339Help
Entry
101217339         CDS       T02486                                 

Definition
(RefSeq) uncharacterized LOC101217339
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00500  Starch and sucrose metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101217339
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101217339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101217339
NCBI-ProteinID: XP_004137176
LinkDB All DBs
Position
4
AA seq 973 aa AA seqDB search
MGPFPLLDAAIEISPRCPIITSRSSYGRRSSHCHLRLTAVSSTRTWKVSYIENLQSKPKT
VAFSSRDNSNDHLTDLVNDADGFSTGRSEVLETGEDEILAVKKALLESQTRQEAVEKERD
QLLERLARYEAKQKEYVATILHDKELAVSELEGARSLFNKKLEESVGEKFALESKLVLAK
QDAIDLAVQVEKLAAIAFQQATSHILEDAQYRVSVAETSAIETSYEIEKQIRDATEGSML
SFLEQSKIAIEKALDVAEKASAHAKKAMATFTDEVYPLDEIASIQSENIKLKGVINELES
HLSLARSNVNNLKLELEQARAQATASEIRAKNAEKVLVEFQELSREKINQQEGEIKLMME
KIKKDVADKKKAASKVFKAELEGIKSAIQAAKETAHSKDSAYMRRCEALQRLLRASEAGT
KMWQQRADMAESFLLKERTMGKDNEDAAYIVNGGRIDLLTDDESQKWKLLSDGPRREIPQ
WMARRIGTIRPKFPPRKIDVTEISVSKFRSLDLPKLEEVWSIAQEKPKVGDTLIEHVIEK
ETIEKKRKALERALQRKTIQWQRTPDQTKLEPGTGTGHEIVFQGFNWESWRRRWYLELAA
KASDLSQSGITAVWLPPPTESVAPQGYMPSDLYNLNSSYGTVEELKYCIEEFHSQDLLAL
GDVVLNHRCAHKQSPSGVWNIFGGKLTWGPEAIVCDDPNFQGRGNPSSGDIFHAAPNIDH
SQDFVRRDIKEWLNWLRNDIGFDGWRLDFVRGFSGTYVKEYIETSNPAFAIGEYWDSLAY
EHGNLCYNQDAHRQRIVNWINATGGTSSAFDVTTKGILHSALHNQYWRMIDPQGKPTGVV
GWWPSRAVTFLENHDTGSTQGHWPFPRDKLAQGYAYILTHPGTPTIFYDHFYDFGIREMI
NELIEARQRAGIHCRSSVKIYHANNEGYVAQVGDTLVMKLGHFDWNPSKENHLDGSWQKF
VDKGSDYQLWLRQ
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgggtccattcccattacttgatgcggcaattgaaatctccccgcgttgccctattatc
acttcgagatcttcatatggcaggcggtcatcacattgccatctccgtttaactgcagtt
tcatctaccaggacctggaaagtctcatacattgaaaacttgcagtctaaaccaaaaact
gttgccttttctagtcgggataattcaaatgatcatttaacagatttggtaaatgatgct
gatggcttttcaactggaagaagtgaagtattagagactggagaggatgaaattcttgca
gttaaaaaagcgcttttggagtctcaaacaagacaagaagcagtagagaaagagagagat
caactacttgagaggttggctcgctatgaggctaaacaaaaagaatatgttgctactata
ttgcatgacaaggaattggcagtttcagaacttgagggggccagatcactctttaataaa
aaactcgaggaatcagtaggtgagaagtttgctttggagtctaagctggttcttgcgaag
caggatgctattgatcttgcagtgcaagttgaaaagttagccgcaattgccttccagcag
gccacctcgcacatattggaagatgctcaatatagagtatcagttgcagaaacttctgct
attgagacgtcttatgaaattgaaaaacagatcagggatgctactgaaggttcaatgctg
tcatttctagaacaatccaaaatagctattgagaaggctttggatgtggctgaaaaagct
agtgctcatgcaaagaaggctatggctacatttactgatgaggtatatcctttagatgag
attgcctctatccaatcagaaaatattaagttgaaaggtgtcatcaatgaattggaatct
cacttatcacttgcaagaagtaatgtcaataacctcaaattggaactggagcaagcccga
gcacaagcaactgcatcagaaattcgagccaaaaatgctgagaaagtattggtcgaattt
caggagttgagcagggaaaagatcaatcaacaggaaggagaaattaaattgatgatggag
aaaatcaagaaagatgtagcagacaagaagaaagctgcttccaaagttttcaaggctgaa
cttgaaggtattaagtctgccattcaagctgccaaagaaactgcacactcaaaagacagc
gcatatatgagaagatgtgaagcactgcaaagattattgagggcatcagaagctggaaca
aagatgtggcaacaacgggctgatatggctgagtcatttttattgaaggaaagaaccatg
ggtaaagataatgaagatgcagcttatattgtcaatggtgggcggatagacctcctaaca
gatgatgagtcacaaaagtggaaactcttgagcgatggtcctcgaagagagatacctcaa
tggatggctagaagaatcggaacaattcgtcccaagtttcctcctagaaagattgatgta
actgaaatttcagtatcaaagtttagatcattggacttgcccaaacttgaggaagtatgg
tcaattgctcaagaaaagccaaaagtaggggatacactaattgagcatgttattgagaaa
gaaacaatagaaaagaagagaaaggctcttgaacgtgcgctgcaacgaaagaccatacaa
tggcagaggacgcctgatcaaacaaaattagaaccaggaactggaactggacacgagatt
gtgtttcaaggtttcaactgggaaagctggagaagacgctggtacctggagttagctgct
aaagcatctgatttatctcagtctggaataacagcagtgtggctcccaccaccgacggag
tctgttgctccacaaggttatatgccatctgacctatataatctgaactcatcttacgga
acagtggaggaactcaagtactgtatagaagaatttcattctcaagatcttctggccctc
ggtgatgttgtactcaatcatagatgtgcacacaagcagagtcccagtggggtttggaac
attttcggtggtaagcttacttgggggcctgaagcaattgtttgtgatgatccaaatttt
cagggtcgaggaaatccttcaagtggcgatatcttccatgcagcaccaaatattgatcac
tcccaggacttcgtgaggagggacataaaagaatggctaaattggcttcgcaatgatatt
ggttttgatgggtggcgtcttgattttgtgaggggtttctcaggtacatatgttaaagaa
tatattgagacttcaaatcctgcttttgctattggagaatactgggacagtttggcttat
gaacatgggaatttatgttataaccaagatgctcatcggcaacgaatagttaattggatc
aatgccacgggtggaacttcctctgcattcgatgttaccaccaagggcatactgcattct
gcacttcataaccaatattggaggatgatagacccacaaggaaaaccaacaggagtagtg
gggtggtggccttcccgtgctgtcactttcttggaaaaccatgacactggctcgacacag
ggacactggccatttccacgtgataaacttgctcaaggatatgcatatatcttgactcat
cctggaacgcctacaattttctacgaccacttttatgattttgggattcgtgaaatgatc
aatgagttaattgaggctcgacaacgtgctggaatccattgtcgaagctcggttaagata
taccatgcaaacaatgaaggatatgttgcacaggttggagatactctggtaatgaagctt
ggacattttgattggaatccctcaaaggaaaatcatttggatgggagctggcagaagttt
gttgacaaaggatcagattaccaactgtggctgagacaataa

DBGET integrated database retrieval system